Human PRDX5/ACR1/AOEB166 ORF/cDNA clone-Lentivirus plasmid (NM_012094)

Cat. No.: pGMLP002999
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PRDX5/ACR1/AOEB166 Lentiviral expression plasmid for PRDX5 lentivirus packaging, PRDX5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PRX5/Prx5/PRDX5/PRDX5/ACR1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $461.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002999
Gene Name PRDX5
Accession Number NM_012094
Gene ID 25824
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 645 bp
Gene Alias ACR1,AOEB166,B166,HEL-S-55,PLP,PMP20,PRDX6,prx-V,PRXV,SBBI10
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGACTAGCTGGCGTGTGCGCCCTGAGACGCTCAGCGGGCTATATACTCGTCGGTGGGGCCGGCGGTCAGTCTGCGGCAGCGGCAGCAAGACGGTACAGTGAAGGAGAGTGGGCGTCTGGCGGGGTCCGCAGTTTCAGCAGAGCCGCTGCAGCCATGGCCCCAATCAAGGTGGGAGATGCCATCCCAGCAGTGGAGGTGTTTGAAGGGGAGCCAGGGAACAAGGTGAACCTGGCAGAGCTGTTCAAGGGCAAGAAGGGTGTGCTGTTTGGAGTTCCTGGGGCCTTCACCCCTGGATGTTCCAAGACACACCTGCCAGGGTTTGTGGAGCAGGCTGAGGCTCTGAAGGCCAAGGGAGTCCAGGTGGTGGCCTGTCTGAGTGTTAATGATGCCTTTGTGACTGGCGAGTGGGGCCGAGCCCACAAGGCGGAAGGCAAGGTTCGGCTCCTGGCTGATCCCACTGGGGCCTTTGGGAAGGAGACAGACTTATTACTAGATGATTCGCTGGTGTCCATCTTTGGGAATCGACGTCTCAAGAGGTTCTCCATGGTGGTACAGGATGGCATAGTGAAGGCCCTGAATGTGGAACCAGATGGCACAGGCCTCACCTGCAGCCTGGCACCCAATATCATCTCACAGCTCTGA
ORF Protein Sequence MGLAGVCALRRSAGYILVGGAGGQSAAAAARRYSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T77009-Ab Anti-PRDX5 monoclonal antibody
    Target Antigen GM-Tg-g-T77009-Ag PRDX5 protein
    ORF Viral Vector pGMLP002999 Human PRDX5 Lentivirus plasmid
    ORF Viral Vector vGMLP002999 Human PRDX5 Lentivirus particle


    Target information

    Target ID GM-T77009
    Target Name PRX5/Prx5/PRDX5
    Gene Group Identifier
    （Target Gene ID in Homo species)         		25824
    Gene ID 100055657 (Equus caballus), 101093462 (Felis catus), 113898 (Rattus norvegicus), 25824 (Homo sapiens)
    282885 (Bos taurus), 476032 (Canis lupus familiaris), 54683 (Mus musculus), 719764 (Macaca mulatta)
    Gene Symbols & Synonyms PRDX5,Prdx5,Aoeb166,PLP,ACR1,B166,PRXV,PMP20,PRDX6,prx-V,SBBI10,AOEB166,HEL-S-55,Prx V,AOPP,PrxV,Pmp20,Prdx6
    Target Alternative Names ACR1,AOEB166,AOPP,Alu corepressor 1,Antioxidant enzyme B166 (AOEB166),Aoeb166,B166,HEL-S-55,Liver tissue 2D-page spot 71B,PLP,PMP20,PRDX5,PRDX6,PRX5,PRXV,Peroxiredoxin V (Prx-V),Peroxiredoxin-5,Peroxisomal antioxidant enzyme,Pmp20,Prdx5,Prdx6,Prx V,Prx5,PrxV,SBBI10,TPx type VI,Thioredoxin peroxidase PMP20,Thioredoxin-dependent peroxiredoxin 5,mitochondrial,prx-V
    Uniprot Accession P30044,P99029,Q9BGI1,Q9R063
    Additional SwissProt Accessions: Q9R063,P30044,Q9BGI1,P99029
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000017747, ENSG00000126432, ENSBTAG00000008648, ENSMUSG00000024953, ENSMMUG00000013397
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.