Human TYROBP/DAP12/KARAP ORF/cDNA clone-Lentivirus plasmid (NM_003332)

Cat. No.: pGMLP002996
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TYROBP/DAP12/KARAP Lentiviral expression plasmid for TYROBP lentivirus packaging, TYROBP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TYROBP/DAP12/TYROBP/DAP12 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002996
Gene Name TYROBP
Accession Number NM_003332
Gene ID 7305
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 342 bp
Gene Alias DAP12,KARAP,PLOSL
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGGGACTTGAACCCTGCAGCAGGCTCCTGCTCCTGCCTCTCCTGCTGGCTGTAAGTGGTCTCCGTCCTGTCCAGGCCCAGGCCCAGAGCGATTGCAGTTGCTCTACGGTGAGCCCGGGCGTGCTGGCAGGGATCGTGATGGGAGACCTGGTGCTGACAGTGCTCATTGCCCTGGCCGTGTACTTCCTGGGCCGGCTGGTCCCTCGGGGGCGAGGGGCTGCGGAGGCAGCGACCCGGAAACAGCGTATCACTGAGACCGAGTCGCCTTATCAGGAGCTCCAGGGTCAGAGGTCGGATGTCTACAGCGACCTCAACACACAGAGGCCGTATTACAAATGA
ORF Protein Sequence MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1895-Ab Anti-TYOBP/ TYROBP/ DAP12 monoclonal antibody
    Target Antigen GM-Tg-g-MP1895-Ag TYROBP VLP (virus-like particle)
    ORF Viral Vector pGMLP002996 Human TYROBP Lentivirus plasmid
    ORF Viral Vector vGMLP002996 Human TYROBP Lentivirus particle


    Target information

    Target ID GM-MP1895
    Target Name TYROBP/DAP12
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7305
    Gene ID 100051740 (Equus caballus), 101082964 (Felis catus), 22177 (Mus musculus), 282390 (Bos taurus)
    361537 (Rattus norvegicus), 476477 (Canis lupus familiaris), 574207 (Macaca mulatta), 7305 (Homo sapiens)
    Gene Symbols & Synonyms TYROBP,Tyrobp,Ly83,DAP12,KARAP,dap12,Karap,PLOSL,PLOSL1
    Target Alternative Names DAP12,DNAX-activation protein 12,KARAP,Karap,Killer-activating receptor-associated protein (KAR-associated protein),Ly83,PLOSL,PLOSL1,TYRO protein tyrosine kinase-binding protein,TYROBP,Tyrobp,dap12
    Uniprot Accession O43914,O54885,Q6X9T7,Q8WNQ8,Q95J79
    Additional SwissProt Accessions: O54885,Q95J79,Q6X9T7,Q8WNQ8,O43914
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Osteoclast differentiation, Natural killer cell mediated cytotoxicity
    Gene Ensembl ENSMUSG00000030579, ENSBTAG00000007338, ENSCAFG00845000649, ENSMMUG00000008004, ENSG00000011600
    Target Classification Pathway


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.