Human CD28/Tp44 ORF/cDNA clone-Lentivirus plasmid (NM_006139)

Cat. No.: pGMLP002973
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD28/Tp44 Lentiviral expression plasmid for CD28 lentivirus packaging, CD28 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CD28/Tp44 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $465.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002973
Gene Name CD28
Accession Number NM_006139
Gene ID 940
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 663 bp
Gene Alias Tp44
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTCAGGCTGCTCTTGGCTCTCAACTTATTCCCTTCAATTCAAGTAACAGGAAACAAGATTTTGGTGAAGCAGTCGCCCATGCTTGTAGCGTACGACAATGCGGTCAACCTTAGCTGCAAGTATTCCTACAATCTCTTCTCAAGGGAGTTCCGGGCATCCCTTCACAAAGGACTGGATAGTGCTGTGGAAGTCTGTGTTGTATATGGGAATTACTCCCAGCAGCTTCAGGTTTACTCAAAAACGGGGTTCAACTGTGATGGGAAATTGGGCAATGAATCAGTGACATTCTACCTCCAGAATTTGTATGTTAACCAAACAGATATTTACTTCTGCAAAATTGAAGTTATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCTGA
ORF Protein Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-326 Pre-Made Lulizumab biosimilar, Single Domain Variable Fragment;L, Anti-CD28 Antibody: Anti-Tp44 therapeutic antibody
    Biosimilar GMP-Bios-INN-715 Pre-Made Acazicolcept Biosimilar, Fusion Protein targeting CD28 fused with human IGHG1 Fc (Fragment constant) via a peptidyl linker: Recombinant therapeutic protein targeting Tp44
    Biosimilar GMP-Bios-INN-901
    Target Antibody GM-Tg-g-T85529-Ab Anti-CD28/ Tp44 monoclonal antibody
    Target Antigen GM-Tg-g-T85529-Ag CD28 VLP (virus-like particle)
    ORF Viral Vector pGMLP002973 Human CD28 Lentivirus plasmid
    ORF Viral Vector pGMPC004751 Human CD28 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002973 Human CD28 Lentivirus particle


    Target information

    Target ID GM-T85529
    Target Name CD28
    Gene Group Identifier
    （Target Gene ID in Homo species)         		940
    Gene ID 100067829 (Equus caballus), 12487 (Mus musculus), 25660 (Rattus norvegicus), 281050 (Bos taurus)
    403646 (Canis lupus familiaris), 493802 (Felis catus), 705313 (Macaca mulatta), 940 (Homo sapiens)
    Gene Symbols & Synonyms CD28,Cd28,CD28RNA,Tp44,IMD123
    Target Alternative Names CD28,CD28RNA,Cd28,IMD123,T-cell-specific surface glycoprotein CD28,TP44,Tp44
    Uniprot Accession O02757,P10747,P31041,P31042,Q28071
    Additional SwissProt Accessions: P31041,P31042,Q28071,O02757,P10747
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease cancer
    Disease from KEGG Cell adhesion molecules, T cell receptor signaling pathway, Intestinal immune network for IgA production, Type I diabetes mellitus, Measles, PD-L1 expression and PD-1 checkpoint pathway in cancer, Autoimmune thyroid disease, Rheumatoid arthritis, Allograft rejection, Graft-versus-host disease, Viral myocarditis
    Gene Ensembl ENSECAG00000022853, ENSMUSG00000026012, ENSBTAG00000007445, ENSCAFG00845018097, ENSMMUG00000057214, ENSG00000178562
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.