Human CD28/Tp44 ORF/cDNA clone-Lentivirus plasmid (NM_006139)
Cat. No.: pGMLP002973
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CD28/Tp44 Lentiviral expression plasmid for CD28 lentivirus packaging, CD28 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CD28/Tp44 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP002973 |
| Gene Name | CD28 |
| Accession Number | NM_006139 |
| Gene ID | 940 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 663 bp |
| Gene Alias | Tp44 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCTCAGGCTGCTCTTGGCTCTCAACTTATTCCCTTCAATTCAAGTAACAGGAAACAAGATTTTGGTGAAGCAGTCGCCCATGCTTGTAGCGTACGACAATGCGGTCAACCTTAGCTGCAAGTATTCCTACAATCTCTTCTCAAGGGAGTTCCGGGCATCCCTTCACAAAGGACTGGATAGTGCTGTGGAAGTCTGTGTTGTATATGGGAATTACTCCCAGCAGCTTCAGGTTTACTCAAAAACGGGGTTCAACTGTGATGGGAAATTGGGCAATGAATCAGTGACATTCTACCTCCAGAATTTGTATGTTAACCAAACAGATATTTACTTCTGCAAAATTGAAGTTATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCTGA |
| ORF Protein Sequence | MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-ab-326 | Pre-Made Lulizumab biosimilar, Single Domain Variable Fragment;L, Anti-CD28 Antibody: Anti-Tp44 therapeutic antibody |
| Biosimilar | GMP-Bios-INN-715 | Pre-Made Acazicolcept Biosimilar, Fusion Protein targeting CD28 fused with human IGHG1 Fc (Fragment constant) via a peptidyl linker: Recombinant therapeutic protein targeting Tp44 |
| Biosimilar | GMP-Bios-INN-901 | |
| Target Antibody | GM-Tg-g-T85529-Ab | Anti-CD28/ Tp44 monoclonal antibody |
| Target Antigen | GM-Tg-g-T85529-Ag | CD28 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP002973 | Human CD28 Lentivirus plasmid |
| ORF Viral Vector | pGMPC004751 | Human CD28 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP002973 | Human CD28 Lentivirus particle |
Target information
| Target ID | GM-T85529 |
| Target Name | CD28 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
940 |
| Gene ID |
100067829 (Equus caballus), 12487 (Mus musculus), 25660 (Rattus norvegicus), 281050 (Bos taurus) 403646 (Canis lupus familiaris), 493802 (Felis catus), 705313 (Macaca mulatta), 940 (Homo sapiens) |
| Gene Symbols & Synonyms | CD28,Cd28,CD28RNA,Tp44,IMD123 |
| Target Alternative Names | CD28,CD28RNA,Cd28,IMD123,T-cell-specific surface glycoprotein CD28,TP44,Tp44 |
| Uniprot Accession |
O02757,P10747,P31041,P31042,Q28071
Additional SwissProt Accessions: P31041,P31042,Q28071,O02757,P10747 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Immuno-oncology Target, INN Index |
| Disease | cancer |
| Disease from KEGG | Cell adhesion molecules, T cell receptor signaling pathway, Intestinal immune network for IgA production, Type I diabetes mellitus, Measles, PD-L1 expression and PD-1 checkpoint pathway in cancer, Autoimmune thyroid disease, Rheumatoid arthritis, Allograft rejection, Graft-versus-host disease, Viral myocarditis |
| Gene Ensembl | ENSECAG00000022853, ENSMUSG00000026012, ENSBTAG00000007445, ENSCAFG00845018097, ENSMMUG00000057214, ENSG00000178562 |
| Target Classification | Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA) |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


