Human SCN1B/ATFB13/BRGDA5 ORF/cDNA clone-Lentivirus plasmid (NM_199037)

Cat. No.: pGMLP002937
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SCN1B/ATFB13/BRGDA5 Lentiviral expression plasmid for SCN1B lentivirus packaging, SCN1B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SCN1B/ATFB13 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $501.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002937
Gene Name SCN1B
Accession Number NM_199037
Gene ID 6324
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 807 bp
Gene Alias ATFB13,BRGDA5,EIEE52,GEFSP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGAGGCTGCTGGCCTTAGTGGTCGGCGCGGCACTGGTGTCCTCAGCCTGCGGGGGCTGCGTGGAGGTGGACTCGGAGACCGAGGCCGTGTATGGGATGACCTTCAAAATTCTTTGCATCTCCTGCAAGCGCCGCAGCGAGACCAACGCTGAGACCTTCACCGAGTGGACCTTCCGCCAGAAGGGCACTGAGGAGTTTGTCAAGATCCTGCGCTATGAGAATGAGGTGTTGCAGCTGGAGGAGGATGAGCGCTTCGAGGGCCGCGTGGTGTGGAATGGCAGCCGGGGCACCAAAGACCTGCAGGATCTGTCTATCTTCATCACCAATGTCACCTACAACCACTCGGGCGACTACGAGTGCCACGTCTACCGCCTGCTCTTCTTCGAAAACTACGAGCACAACACCAGCGTCGTCAAGAAGATCCACATTGAGGTAGTGGACAAAGGTGAGTCGGGTGCTGCCTGCCCCTTTACCGTCACCCACCGGAGAGCCAGATGGAGGGACAGATGGCAGGCAGTGGACAGGACAGGCTGGCTCTGTGCCTGGCCAGCCAACCGCCCACAGCAGCGGGCTGAGGGGGAGGGGAGCAGCCCCTCCTGCCCACTCCAGCTCTGGCCTCTGTTTCTCTCCAGCCCACGGAGAGGTCAAAGCATGCCTGTCCCCCACAGACGCTCCGGGTACAGAACCCAGCTCTGTCACCTGTGCTGTATGACCTCTGGCAGGTGCCTTCTGTCTCTGAGCCAAAGGGTTGTCCTGGGCTTGCCCGGGATAATAATCCGATGTGTTTCTCGGGGTGTGGTTTGA
ORF Protein Sequence MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKGESGAACPFTVTHRRARWRDRWQAVDRTGWLCAWPANRPQQRAEGEGSSPSCPLQLWPLFLSSPRRGQSMPVPHRRSGYRTQLCHLCCMTSGRCLLSLSQRVVLGLPGIIIRCVSRGVV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1487-Ab Anti-SCN1B/ ATFB13/ BRGDA5 monoclonal antibody
    Target Antigen GM-Tg-g-MP1487-Ag SCN1B VLP (virus-like particle)
    ORF Viral Vector pGMLP002937 Human SCN1B Lentivirus plasmid
    ORF Viral Vector vGMLP002937 Human SCN1B Lentivirus particle


    Target information

    Target ID GM-MP1487
    Target Name SCN1B
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6324
    Gene ID 100050415 (Equus caballus), 101101526 (Felis catus), 20266 (Mus musculus), 29686 (Rattus norvegicus)
    484584 (Canis lupus familiaris), 618204 (Bos taurus), 6324 (Homo sapiens), 707134 (Macaca mulatta)
    Gene Symbols & Synonyms SCN1B,Scn1b,DEE52,ATFB13,BRGDA5,EIEE52,GEFSP1
    Target Alternative Names ATFB13,BRGDA5,DEE52,EIEE52,GEFSP1,SCN1B,Scn1b,Sodium channel regulatory subunit beta-1
    Uniprot Accession P97952,Q00954,Q07699,Q17QN4,Q4PPC4
    Additional SwissProt Accessions: P97952,Q00954,Q4PPC4,Q17QN4,Q07699
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Adrenergic signaling in cardiomyocytes
    Gene Ensembl ENSECAG00000000179, ENSMUSG00000019194, ENSCAFG00845003824, ENSBTAG00000003826, ENSG00000105711, ENSMMUG00000004843
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.