Human SPINK1/PCTT/PSTI ORF/cDNA clone-Lentivirus plasmid (NM_003122)

Cat. No.: pGMLP002897
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SPINK1/PCTT/PSTI Lentiviral expression plasmid for SPINK1 lentivirus packaging, SPINK1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SPINK1/PCTT products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002897
Gene Name SPINK1
Accession Number NM_003122
Gene ID 6690
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 240 bp
Gene Alias PCTT,PSTI,Spink3,TATI,TCP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGGTAACAGGCATCTTTCTTCTCAGTGCCTTGGCCCTGTTGAGTCTATCTGGTAACACTGGAGCTGACTCCCTGGGAAGAGAGGCCAAATGTTACAATGAACTTAATGGATGCACCAAGATATATGACCCTGTCTGTGGGACTGATGGAAATACTTATCCCAATGAATGCGTGTTATGTTTTGAAAATCGGAAACGCCAGACTTCTATCCTCATTCAAAAATCTGGGCCTTGCTGA
ORF Protein Sequence MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1309-Ab Anti-ISK1/ SPINK1/ PCTT functional antibody
    Target Antigen GM-Tg-g-SE1309-Ag SPINK1 protein
    ORF Viral Vector pGMLP002897 Human SPINK1 Lentivirus plasmid
    ORF Viral Vector vGMLP002897 Human SPINK1 Lentivirus particle


    Target information

    Target ID GM-SE1309
    Target Name SPINK1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6690
    Gene ID 100630883 (Equus caballus), 101085948 (Felis catus), 20730 (Mus musculus), 574092 (Bos taurus)
    608433 (Canis lupus familiaris), 6690 (Homo sapiens), 708951 (Macaca mulatta)
    Gene Symbols & Synonyms SPINK1,Spink1,PSTI,p12,Spink3,TCP,PCTT,TATI
    Target Alternative Names PCTT,PSTI,Pancreatic secretory trypsin inhibitor,SPINK1,Serine protease inhibitor Kazal-type 1,Spink1,Spink3,TATI,TCP,Tumor-associated trypsin inhibitor (TATI),p12
    Uniprot Accession P00995,P00996,P04542,P09036,P81634
    Additional SwissProt Accessions: P81634,P09036,P00996,P04542,P00995
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease cancer, Prostate Cancer
    Disease from KEGG
    Gene Ensembl ENSMUSG00000024503, ENSBTAG00000015558, ENSCAFG00845025025, ENSG00000164266, ENSMMUG00000017227
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.