Human RTN4/ASY/Nbla00271 ORF/cDNA clone-Lentivirus plasmid (NM_007008)

Cat. No.: pGMLP002802
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RTN4/ASY/Nbla00271 Lentiviral expression plasmid for RTN4 lentivirus packaging, RTN4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RTN4/NOGO/RTN4/ASY products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002802
Gene Name RTN4
Accession Number NM_007008
Gene ID 57142
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 600 bp
Gene Alias ASY,Nbla00271,Nbla10545,NI220/250,NOGO,NSP,NSP-CL,RTN-X,RTN4-A,RTN4-B1,RTN4-B2,RTN4-C
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACGGTCAGAAGAAAAATTGGAAGGACAAGGTTGTTGACCTCCTGTACTGGAGAGACATTAAGAAGACTGGAGTGGTGTTTGGTGCCAGCCTATTCCTGCTGCTTTCATTGACAGTATTCAGCATTGTGAGCGTAACAGCCTACATTGCCTTGGCCCTGCTCTCTGTGACCATCAGCTTTAGGATATACAAGGGTGTGATCCAAGCTATCCAGAAATCAGATGAAGGCCACCCATTCAGGGCATATCTGGAATCTGAAGTTGCTATATCTGAGGAGTTGGTTCAGAAGTACAGTAATTCTGCTCTTGGTCATGTGAACTGCACGATAAAGGAACTCAGGCGCCTCTTCTTAGTTGATGATTTAGTTGATTCTCTGAAGTTTGCAGTGTTGATGTGGGTATTTACCTATGTTGGTGCCTTGTTTAATGGTCTGACACTACTGATTTTGGCTCTCATTTCACTCTTCAGTGTTCCTGTTATTTATGAACGGCATCAGGCACAGATAGATCATTATCTAGGACTTGCAAATAAGAATGTTAAAGATGCTATGGCTAAAATCCAAGCAAAAATCCCTGGATTGAAGCGCAAAGCTGAATGA
ORF Protein Sequence MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-037 Pre-Made Atinumab biosimilar, Whole mAb, Anti-RTN4 Antibody: Anti-ASY/NI220/250/NOGO/NSP/NSP-CL/Nbla00271/Nbla10545/RTN-X-B1-B2 therapeutic antibody
    Biosimilar GMP-Bios-ab-418 Pre-Made Ozanezumab biosimilar, Whole mAb, Anti-RTN4 Antibody: Anti-ASY/NI220/250/NOGO/NSP/NSP-CL/Nbla00271/Nbla10545/RTN-X-B1-B2 therapeutic antibody
    Target Antibody GM-Tg-g-T70062-Ab Anti-RTN4/ ASY/ NI220/250 monoclonal antibody
    Target Antigen GM-Tg-g-T70062-Ag RTN4 VLP (virus-like particle)
    ORF Viral Vector pGMLP002802 Human RTN4 Lentivirus plasmid
    ORF Viral Vector pGMLV001875 Human RTN4 Lentivirus plasmid
    ORF Viral Vector pGMAD001226 Human RTN4 Adenovirus plasmid
    ORF Viral Vector pGMPC000891 Human RTN4 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002802 Human RTN4 Lentivirus particle
    ORF Viral Vector vGMLV001875 Human RTN4 Lentivirus particle
    ORF Viral Vector vGMAD001226 Human RTN4 Adenovirus particle


    Target information

    Target ID GM-T70062
    Target Name RTN4/NOGO
    Gene Group Identifier
    (Target Gene ID in Homo species)
    57142
    Gene ID 100066612 (Equus caballus), 101091611 (Felis catus), 359718 (Bos taurus), 474598 (Canis lupus familiaris)
    57142 (Homo sapiens), 619181 (Macaca mulatta), 68585 (Mus musculus), 83765 (Rattus norvegicus)
    Gene Symbols & Synonyms RTN4,Rtn4,ASY,NSP,NOGO,RTN-X,NSP-CL,RTN4-A,RTN4-C,RTN4-B1,RTN4-B2,NI220/250,Nbla00271,Nbla10545,RTN4-Cw,NgA,Nogo-A,Nogo-B,Nogo-C,mKIAA0886,mKIAA4153,1110020G17Rik,C130026I10Rik,Nogo,Vp20,rat N,NI-250,rat NogoA
    Target Alternative Names RTN4, NOGO,Reticulon-4,Foocen, Neurite outgrowth inhibitor (Nogo protein), Neuroendocrine-specific protein (NSP), Neuroendocrine-specific protein C homolog, RTN-x, Reticulon-5,ASY,NSP,NOGO,RTN-X,NSP-CL,RTN4-A,RTN4-C,RTN4-B1,RTN4-B2,NI220/250,Nbla00271,Nbla10545
    Uniprot Accession Q99P72,Q9JK11,Q9NQC3
    Additional SwissProt Accessions: Q9NQC3,Q99P72,Q9JK11
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index
    Disease
    Disease from KEGG Alzheimer disease
    Gene Ensembl ENSECAG00000011846, ENSBTAG00000011104, ENSCAFG00845010381, ENSG00000115310, ENSMMUG00000021299, ENSMUSG00000020458
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.