Human LTA/LT/TNFB ORF/cDNA clone-Lentivirus plasmid (NM_000595)
Cat. No.: pGMLP002777
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human LTA/LT/TNFB Lentiviral expression plasmid for LTA lentivirus packaging, LTA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
TNF Beta/TNF beta/LTA/LTA/LT products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP002777 |
| Gene Name | LTA |
| Accession Number | NM_000595 |
| Gene ID | 4049 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 618 bp |
| Gene Alias | LT,TNFB,TNFSF1,TNLG1E |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGACACCACCTGAACGTCTCTTCCTCCCAAGGGTGTGTGGCACCACCCTACACCTCCTCCTTCTGGGGCTGCTGCTGGTTCTGCTGCCTGGGGCCCAGGGGCTCCCTGGTGTTGGCCTCACACCTTCAGCTGCCCAGACTGCCCGTCAGCACCCCAAGATGCATCTTGCCCACAGCACCCTCAAACCTGCTGCTCACCTCATTGGAGACCCCAGCAAGCAGAACTCACTGCTCTGGAGAGCAAACACGGACCGTGCCTTCCTCCAGGATGGTTTCTCCTTGAGCAACAATTCTCTCCTGGTCCCCACCAGTGGCATCTACTTCGTCTACTCCCAGGTGGTCTTCTCTGGGAAAGCCTACTCTCCCAAGGCCACCTCCTCCCCACTCTACCTGGCCCATGAGGTCCAGCTCTTCTCCTCCCAGTACCCCTTCCATGTGCCTCTCCTCAGCTCCCAGAAGATGGTGTATCCAGGGCTGCAGGAACCCTGGCTGCACTCGATGTACCACGGGGCTGCGTTCCAGCTCACCCAGGGAGACCAGCTATCCACCCACACAGATGGCATCCCCCACCTAGTCCTCAGCCCTAGTACTGTCTTCTTTGGAGCCTTCGCTCTGTAG |
| ORF Protein Sequence | MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-INN-749 | Pre-Made Baminercept Biosimilar, Fusion Protein targeting LTA fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting LT/TNFB/TNFSF1/TNLG1E |
| Biosimilar | GMP-Bios-ab-430 | Pre-Made Pateclizumab biosimilar, Whole mAb, Anti-LTA Antibody: Anti-LT/TNFB/TNFSF1/TNLG1E therapeutic antibody |
| Target Antibody | GM-Tg-g-T85158-Ab | Anti-TNFB/ LTA/ LT monoclonal antibody |
| Target Antigen | GM-Tg-g-T85158-Ag | LTA VLP (virus-like particle) |
| ORF Viral Vector | pGMLP002777 | Human LTA Lentivirus plasmid |
| ORF Viral Vector | vGMLP002777 | Human LTA Lentivirus particle |
Target information
| Target ID | GM-T85158 |
| Target Name | TNF Beta/TNF beta/LTA |
|
Gene Group Identifier (Target Gene ID in Homo species) |
4049 |
| Gene ID |
100058321 (Equus caballus), 101084961 (Felis catus), 16992 (Mus musculus), 25008 (Rattus norvegicus) 280845 (Bos taurus), 4049 (Homo sapiens), 607183 (Canis lupus familiaris), 715425 (Macaca mulatta) |
| Gene Symbols & Synonyms | LTA,Lta,TNLG1E,LT,Ltx,Tnfb,LT[a],LT-[a],TNFSF1,Tnlg1e,hlb382,LTalpha,Tnfsf1b,LT-alpha,TNF-beta,TNFB |
| Target Alternative Names | LT,LT-[a],LT-alpha,LTA,LT[a],LTalpha,Lta,Ltx,Lymphotoxin-alpha,TNF Beta,TNF beta,TNF-beta,TNFB,TNFSF1,TNLG1E,Tnfb,Tnfsf1b,Tnlg1e,Tumor necrosis factor ligand superfamily member 1,hlb382 |
| Uniprot Accession |
P01374,P09225,Q06332,Q06600,Q5TM20,Q5WR07
Additional SwissProt Accessions: P09225,Q06332,Q06600,P01374,Q5WR07,Q5TM20 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, INN Index |
| Disease | cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, NF-kappa B signaling pathway, TNF signaling pathway, Type I diabetes mellitus, Human T-cell leukemia virus 1 infection |
| Gene Ensembl | ENSMUSG00000024402, ENSBTAG00000000016, ENSG00000226979, ENSCAFG00845010521, ENSMMUG00000008843 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


