Human GSTP1/DFN7/FAEES3 ORF/cDNA clone-Lentivirus plasmid (NM_000852)

Cat. No.: pGMLP002766
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GSTP1/DFN7/FAEES3 Lentiviral expression plasmid for GSTP1 lentivirus packaging, GSTP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to GSTP1/DFN7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $458.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002766
Gene Name GSTP1
Accession Number NM_000852
Gene ID 2950
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 633 bp
Gene Alias DFN7,FAEES3,GST3,GSTP,HEL-S-22,PI
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCGCCCTACACCGTGGTCTATTTCCCAGTTCGAGGCCGCTGCGCGGCCCTGCGCATGCTGCTGGCAGATCAGGGCCAGAGCTGGAAGGAGGAGGTGGTGACCGTGGAGACGTGGCAGGAGGGCTCACTCAAAGCCTCCTGCCTATACGGGCAGCTCCCCAAGTTCCAGGACGGAGACCTCACCCTGTACCAGTCCAATACCATCCTGCGTCACCTGGGCCGCACCCTTGGGCTCTATGGGAAGGACCAGCAGGAGGCAGCCCTGGTGGACATGGTGAATGACGGCGTGGAGGACCTCCGCTGCAAATACATCTCCCTCATCTACACCAACTATGAGGCGGGCAAGGATGACTATGTGAAGGCACTGCCCGGGCAACTGAAGCCTTTTGAGACCCTGCTGTCCCAGAACCAGGGAGGCAAGACCTTCATTGTGGGAGACCAGATCTCCTTCGCTGACTACAACCTGCTGGACTTGCTGCTGATCCATGAGGTCCTAGCCCCTGGCTGCCTGGATGCGTTCCCCCTGCTCTCAGCATATGTGGGGCGCCTCAGTGCCCGGCCCAAGCTCAAGGCCTTCCTGGCCTCCCCTGAGTACGTGAACCTCCCCATCAATGGCAACGGGAAACAGTGA
ORF Protein Sequence MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T21669-Ab Anti-GSTP1 monoclonal antibody
    Target Antigen GM-Tg-g-T21669-Ag GSTP1 protein
    ORF Viral Vector pGMLP002766 Human GSTP1 Lentivirus plasmid
    ORF Viral Vector pGMLP003915 Human GSTP1 Lentivirus plasmid
    ORF Viral Vector vGMLP002766 Human GSTP1 Lentivirus particle
    ORF Viral Vector vGMLP003915 Human GSTP1 Lentivirus particle


    Target information

    Target ID GM-T21669
    Target Name GSTP1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		2950
    Gene ID 100059533 (Equus caballus), 101082184 (Felis catus), 24426 (Rattus norvegicus), 2950 (Homo sapiens)
    476005 (Canis lupus familiaris), 525938 (Bos taurus), 721704 (Macaca mulatta)
    Gene Symbols & Synonyms GSTP1,Gstp1,Gst3,Gstp,GST-P,Gstp2,PI,DFN7,GST3,GSTP,FAEES3,HEL-S-22
    Target Alternative Names DFN7,FAEES3,GST class-pi,GST-P,GST3,GSTP,GSTP1,GSTP1-1,Glutathione S-transferase P,Gst3,Gstp,Gstp1,Gstp2,HEL-S-22,PI
    Uniprot Accession P04906,P09211,Q28514
    Additional SwissProt Accessions: P04906,P09211,Q28514
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, Exercise, Congenital occlusion of ureteropelvic junction, Acute kidney failure
    Disease from KEGG Metabolic pathways, Pathways in cancer, Chemical carcinogenesis - DNA adducts, Prostate cancer, Hepatocellular carcinoma, Fluid shear stress and atherosclerosis, Drug metabolism - cytochrome P450
    Gene Ensembl ENSECAG00000020462, ENSG00000084207, ENSCAFG00845009240, ENSMMUG00000018524
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.