Human CXCL3/CINC-2b/GRO3 ORF/cDNA clone-Lentivirus plasmid (NM_002090)

Cat. No.: pGMLP002748
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CXCL3/CINC-2b/GRO3 Lentiviral expression plasmid for CXCL3 lentivirus packaging, CXCL3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CXCL3/GRO Gamma/CXCL3/CINC-2b products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002748
Gene Name CXCL3
Accession Number NM_002090
Gene ID 2921
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 324 bp
Gene Alias CINC-2b,GRO3,GROg,MIP-2b,MIP2B,SCYB3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCACGCCACGCTCTCCGCCGCCCCCAGCAATCCCCGGCTCCTGCGGGTGGCGCTGCTGCTCCTGCTCCTGGTGGCCGCCAGCCGGCGCGCAGCAGGAGCGTCCGTGGTCACTGAACTGCGCTGCCAGTGCTTGCAGACACTGCAGGGAATTCACCTCAAGAACATCCAAAGTGTGAATGTAAGGTCCCCCGGACCCCACTGCGCCCAAACCGAAGTCATAGCCACACTCAAGAATGGGAAGAAAGCTTGTCTCAACCCCGCATCCCCCATGGTTCAGAAAATCATCGAAAAGATACTGAACAAGGGGAGCACCAACTGA
ORF Protein Sequence MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0843-Ab Anti-CXCL3/ CINC-2b/ GRO3 functional antibody
    Target Antigen GM-Tg-g-SE0843-Ag CXCL3 protein
    Cytokine cks-Tg-g-GM-SE0843 chemokine (C-X-C motif) ligand 3 (CXCL3) protein & antibody
    ORF Viral Vector pGMLP002748 Human CXCL3 Lentivirus plasmid
    ORF Viral Vector vGMLP002748 Human CXCL3 Lentivirus particle


    Target information

    Target ID GM-SE0843
    Target Name CXCL3/GRO Gamma
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2921
    Gene ID 2921 (Homo sapiens)
    Gene Symbols & Synonyms CXCL3,GRO3,GROg,MIP2B,SCYB3,MIP-2b,CINC-2b
    Target Alternative Names C-X-C motif chemokine 3,CINC-2b,CXCL3,GRO Gamma,GRO-gamma(1-73),GRO3,GROg,Growth-regulated protein gamma (GRO-gamma),MIP-2b,MIP2B,Macrophage inflammatory protein 2-beta (MIP2-beta),SCYB3
    Uniprot Accession P19876
    Additional SwissProt Accessions: P19876
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, NF-kappa B signaling pathway, NOD-like receptor signaling pathway, IL-17 signaling pathway, TNF signaling pathway, Alcoholic liver disease, Epithelial cell signaling in Helicobacter pylori infection, Legionellosis, Amoebiasis, Kaposi sarcoma-associated herpesvirus infection, Rheumatoid arthritis, Lipid and atherosclerosis
    Gene Ensembl ENSG00000163734
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.