Human CD82/4F9/C33 ORF/cDNA clone-Lentivirus plasmid (NM_002231)

Cat. No.: pGMLP002734
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD82/4F9/C33 Lentiviral expression plasmid for CD82 lentivirus packaging, CD82 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CD82/4F9 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $501
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002734
Gene Name CD82
Accession Number NM_002231
Gene ID 3732
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 804 bp
Gene Alias 4F9,C33,GR15,IA4,KAI1,R2,SAR2,ST6,TSPAN27
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCTCAGCCTGTATCAAAGTCACCAAATACTTTCTCTTCCTCTTCAACTTGATCTTCTTTATCCTGGGCGCAGTGATCCTGGGCTTCGGGGTGTGGATCCTGGCCGACAAGAGCAGTTTCATCTCTGTCCTGCAAACCTCCTCCAGCTCGCTTAGGATGGGGGCCTATGTCTTCATCGGCGTGGGGGCAGTCACTATGCTCATGGGCTTCCTGGGCTGCATCGGCGCCGTCAACGAGGTCCGCTGCCTGCTGGGGCTGTACTTTGCTTTCCTGCTCCTGATCCTCATTGCCCAGGTGACGGCCGGGGCCCTCTTCTACTTCAACATGGGCAAGCTGAAGCAGGAGATGGGCGGCATCGTGACTGAGCTCATTCGAGACTACAACAGCAGTCGCGAGGACAGCCTGCAGGATGCCTGGGACTACGTGCAGGCTCAGGTGAAGTGCTGCGGCTGGGTCAGCTTCTACAACTGGACAGACAACGCTGAGCTCATGAATCGCCCTGAGGTCACCTACCCCTGTTCCTGCGAAGTCAAGGGGGAAGAGGACAACAGCCTTTCTGTGAGGAAGGGCTTCTGCGAGGCCCCCGGCAACAGGACCCAGAGTGGCAACCACCCTGAGGACTGGCCTGTGTACCAGGAGGGCTGCATGGAGAAGGTGCAGGCGTGGCTGCAGGAGAACCTGGGCATCATCCTCGGCGTGGGCGTGGGTGTGGCCATCATCGAGCTCCTGGGGATGGTCCTGTCCATCTGCTTGTGCCGGCACGTCCATTCCGAAGACTACAGCAAGGTCCCCAAGTACTGA
ORF Protein Sequence MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0218-Ab Anti-CD82/ 4F9/ C33 monoclonal antibody
    Target Antigen GM-Tg-g-MP0218-Ag CD82 VLP (virus-like particle)
    ORF Viral Vector pGMLP002734 Human CD82 Lentivirus plasmid
    ORF Viral Vector pGMLP004034 Human CD82 Lentivirus plasmid
    ORF Viral Vector vGMLP002734 Human CD82 Lentivirus particle
    ORF Viral Vector vGMLP004034 Human CD82 Lentivirus particle


    Target information

    Target ID GM-MP0218
    Target Name CD82
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3732
    Gene ID 100056000 (Equus caballus), 101084137 (Felis catus), 119864234 (Canis lupus familiaris), 12521 (Mus musculus)
    3732 (Homo sapiens), 506713 (Bos taurus), 715606 (Macaca mulatta), 83628 (Rattus norvegicus)
    Gene Symbols & Synonyms CD82,Cd82,C33,IA4,Kai1,Tspan27,R2,4F9,ST6,GR15,KAI1,SAR2,TSPAN27
    Target Alternative Names 4F9,C33,C33 antigen,CD82,CD82 antigen,Cd82,GR15,IA4,Inducible membrane protein R2,KAI1,Kai1,Metastasis suppressor Kangai-1,R2,SAR2,ST6,Suppressor of tumorigenicity 6 protein,TSPAN27,Tetraspanin-27 (Tspan-27),Tspan27
    Uniprot Accession O70352,P27701,P40237
    Additional SwissProt Accessions: P40237,P27701,O70352
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer
    Disease from KEGG p53 signaling pathway
    Gene Ensembl ENSECAG00000020051, ENSCAFG00845005975, ENSMUSG00000027215, ENSG00000085117, ENSBTAG00000031252, ENSMMUG00000019268
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.