Human BCL2/Bcl-2/PPP1R50 ORF/cDNA clone-Lentivirus plasmid (NM_000633)

Cat. No.: pGMLP002721
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human BCL2/Bcl-2/PPP1R50 Lentiviral expression plasmid for BCL2 lentivirus packaging, BCL2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to BCL2/BCL-2/BCL2/Bcl-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $480
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002721
Gene Name BCL2
Accession Number NM_000633
Gene ID 596
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 720 bp
Gene Alias Bcl-2,PPP1R50
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGCACGCTGGGAGAACAGGGTACGATAACCGGGAGATAGTGATGAAGTACATCCATTATAAGCTGTCGCAGAGGGGCTACGAGTGGGATGCGGGAGATGTGGGCGCCGCGCCCCCGGGGGCCGCCCCCGCACCGGGCATCTTCTCCTCCCAGCCCGGGCACACGCCCCATCCAGCCGCATCCCGGGACCCGGTCGCCAGGACCTCGCCGCTGCAGACCCCGGCTGCCCCCGGCGCCGCCGCGGGGCCTGCGCTCAGCCCGGTGCCACCTGTGGTCCACCTGACCCTCCGCCAGGCCGGCGACGACTTCTCCCGCCGCTACCGCCGCGACTTCGCCGAGATGTCCAGCCAGCTGCACCTGACGCCCTTCACCGCGCGGGGACGCTTTGCCACGGTGGTGGAGGAGCTCTTCAGGGACGGGGTGAACTGGGGGAGGATTGTGGCCTTCTTTGAGTTCGGTGGGGTCATGTGTGTGGAGAGCGTCAACCGGGAGATGTCGCCCCTGGTGGACAACATCGCCCTGTGGATGACTGAGTACCTGAACCGGCACCTGCACACCTGGATCCAGGATAACGGAGGCTGGGATGCCTTTGTGGAACTGTACGGCCCCAGCATGCGGCCTCTGTTTGATTTCTCCTGGCTGTCTCTGAAGACTCTGCTCAGTTTGGCCCTGGTGGGAGCTTGCATCACCCTGGGTGCCTATCTGGGCCACAAGTGA
ORF Protein Sequence MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0014-Ab Anti-BCL-2 monoclonal antibody
    Target Antigen GM-Tg-g-IP0014-Ag BCL-2/BCL2 protein
    ORF Viral Vector pGMLP002721 Human BCL2 Lentivirus plasmid
    ORF Viral Vector pGMLP005806 Human BCL2 Lentivirus plasmid
    ORF Viral Vector pGMLP-SPh-016 Human BCL2 Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-156 Human BCL2 Adenovirus plasmid
    ORF Viral Vector pGMPC000248 Human BCL2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC000848 Human BCL2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002721 Human BCL2 Lentivirus particle
    ORF Viral Vector vGMLP005806 Human BCL2 Lentivirus particle
    ORF Viral Vector vGMLP-SPh-016 Human BCL2 Lentivirus particle
    ORF Viral Vector vGMAP-SPh-156 Human BCL2 Adenovirus particle


    Target information

    Target ID GM-IP0014
    Target Name BCL2/BCL-2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    596
    Gene ID 100050934 (Equus caballus), 12043 (Mus musculus), 24224 (Rattus norvegicus), 281020 (Bos taurus)
    403416 (Canis lupus familiaris), 493934 (Felis catus), 596 (Homo sapiens), 707407 (Macaca mulatta)
    Gene Symbols & Synonyms BCL2,Bcl2,Bcl-2,C430015F12Rik,D630044D05Rik,D830018M01Rik,BCL-2,bcl-2,PPP1R50
    Target Alternative Names Apoptosis regulator Bcl-2,BCL-2,BCL2,Bcl-2,Bcl2,C430015F12Rik,D630044D05Rik,D830018M01Rik,PPP1R50,bcl-2
    Uniprot Accession O02718,P10415,P10417,P49950,Q6R755
    Additional SwissProt Accessions: P10417,P49950,O02718,Q6R755,P10415
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease cancer, Breast Cancer, immune cells or tumors
    Disease from KEGG EGFR tyrosine kinase inhibitor resistance, Endocrine resistance, NF-kappa B signaling pathway, HIF-1 signaling pathway, Sphingolipid signaling pathway, p53 signaling pathway, Protein processing in endoplasmic reticulum, PI3K-Akt signaling pathway, Apoptosis, Apoptosis - multiple species, Adrenergic signaling in cardiomyocytes, Focal adhesion, NOD-like receptor signaling pathway, JAK-STAT signaling pathway, Neurotrophin signaling pathway, Cholinergic synapse, Parathyroid hormone synthesis, secretion and action, AGE-RAGE signaling pathway in diabetic complications, Toxoplasmosis, Tuberculosis, Hepatitis B, Measles, Epstein-Barr virus infection, Pathways in cancer, Chemical carcinogenesis - receptor activation, Colorectal cancer, Prostate cancer, Small cell lung cancer, Gastric cancer, Lipid and atherosclerosis, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSECAG00000020437, ENSMUSG00000057329, ENSBTAG00000019302, ENSCAFG00845002725, ENSG00000171791, ENSMMUG00000059194
    Target Classification Pathway, Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.