Human CXCL5/ENA-78/SCYB5 ORF/cDNA clone-Lentivirus plasmid (NM_002994)

Cat. No.: pGMLP002668
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CXCL5/ENA-78/SCYB5 Lentiviral expression plasmid for CXCL5 lentivirus packaging, CXCL5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to LIX/CXCL5/CXCL5/ENA-78 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002668
Gene Name CXCL5
Accession Number NM_002994
Gene ID 6374
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 345 bp
Gene Alias ENA-78,SCYB5
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCCTCCTGTCCAGCCGCGCGGCCCGTGTCCCCGGTCCTTCGAGCTCCTTGTGCGCGCTGTTGGTGCTGCTGCTGCTGCTGACGCAGCCAGGGCCCATCGCCAGCGCTGGTCCTGCCGCTGCTGTGTTGAGAGAGCTGCGTTGCGTTTGTTTACAGACCACGCAAGGAGTTCATCCCAAAATGATCAGTAATCTGCAAGTGTTCGCCATAGGCCCACAGTGCTCCAAGGTGGAAGTGGTAGCCTCCCTGAAGAACGGGAAGGAAATTTGTCTTGATCCAGAAGCCCCTTTTCTAAAGAAAGTCATCCAGAAAATTTTGGACGGTGGAAACAAGGAAAACTGA
ORF Protein Sequence MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0844-Ab Anti-CXCL5/ ENA-78/ SCYB5 functional antibody
    Target Antigen GM-Tg-g-SE0844-Ag CXCL5 protein
    Cytokine cks-Tg-g-GM-SE0844 chemokine (C-X-C motif) ligand 15 (CXCL15) protein & antibody
    ORF Viral Vector pGMLP002668 Human CXCL5 Lentivirus plasmid
    ORF Viral Vector vGMLP002668 Human CXCL5 Lentivirus particle


    Target information

    Target ID GM-SE0844
    Target Name LIX/CXCL5
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6374
    Gene ID 6374 (Homo sapiens)
    Gene Symbols & Synonyms CXCL5,SCYB5,ENA-78
    Target Alternative Names C-X-C motif chemokine 5,CXCL5,ENA-78,ENA-78(1-78),Epithelial-derived neutrophil-activating protein 78,LIX,Neutrophil-activating peptide ENA-78,SCYB5,Small-inducible cytokine B5
    Uniprot Accession P42830
    Additional SwissProt Accessions: P42830
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease cancer, Prostate Cancer, Malignant neoplasm of bladder
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, IL-17 signaling pathway, TNF signaling pathway, Pertussis, Rheumatoid arthritis
    Gene Ensembl ENSG00000163735
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.