Human NAT8/ATase2/CCNAT ORF/cDNA clone-Lentivirus plasmid (NM_003960)

Cat. No.: pGMLP002633
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NAT8/ATase2/CCNAT Lentiviral expression plasmid for NAT8 lentivirus packaging, NAT8 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to NAT8/ATase2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $471
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002633
Gene Name NAT8
Accession Number NM_003960
Gene ID 9027
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 684 bp
Gene Alias ATase2,CCNAT,CML1,GLA,Hcml1,TSC501,TSC510
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCCTTGTCACATCCGCAAATACCAGGAGAGCGACCGCCAGTGGGTTGTGGGCTTGCTCTCCCGGGGGATGGCCGAGCATGCCCCAGCCACCTTCCGGCAATTGCTGAAGCTGCCTCGAACCCTCATACTCTTACTTGGGGGGCCCCTCGCCCTACTCCTGGTCTCTGGATCCTGGCTTCTAGCCCTCGTGTTCAGCATCAGCCTCTTCCCTGCCCTGTGGTTCCTTGCCAAAAAACCCTGGACGGAGTATGTGGACATGACATTGTGCACAGACATGTCTGACATTACCAAATCCTACCTGAGTGAGCGTGGCTCCTGCTTCTGGGTGGCTGAGTCTGAAGAGAAGGTGGTGGGCATGGTAGGAGCTCTGCCTGTTGATGATCCCACCTTGAGGGAGAAGCGGTTGCAGCTGTTTCATCTCTTTGTGGACAGTGAGCACCGTCGTCAGGGGATAGCAAAAGCCCTGGTCAGGACTGTCCTCCAGTTTGCCCGGGACCAGGGCTACAGTGAAGTTATCCTGGACACCGGCACCATCCAGCTCTCTGCTATGGCCCTCTACCAGAGCATGGGCTTCAAGAAGACGGGCCAGTCCTTCTTCTGTGTGTGGGCCAGGCTAGTGGCTCTTCATACAGTTCATTTCATCTACCACCTCCCTTCTTCTAAGGTAGGGAGTCTGTGA
ORF Protein Sequence MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1235-Ab Anti-NAT8 monoclonal antibody
    Target Antigen GM-Tg-g-IP1235-Ag NAT8 protein
    ORF Viral Vector pGMLP002633 Human NAT8 Lentivirus plasmid
    ORF Viral Vector vGMLP002633 Human NAT8 Lentivirus particle


    Target information

    Target ID GM-IP1235
    Target Name NAT8
    Gene Group Identifier
    （Target Gene ID in Homo species)         		9027
    Gene ID 100856478 (Canis lupus familiaris), 101098621 (Felis catus), 101902604 (Bos taurus), 706820 (Macaca mulatta)
    9027 (Homo sapiens)
    Gene Symbols & Synonyms NAT8,NAT8B,GLA,CML1,CCNAT,Hcml1,ATase2,TSC501,TSC510
    Target Alternative Names ATase2,Acetyltransferase 2 (ATase2),CCNAT,CML1,Camello-like protein 1,Cysteinyl-conjugate N-acetyltransferase (CCNAT),GLA,Hcml1,N-acetyltransferase 8,NAT8,NAT8B,TSC501,TSC510
    Uniprot Accession Q9UHE5
    Additional SwissProt Accessions: Q9UHE5
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG Metabolic pathways
    Gene Ensembl ENSMMUG00000048536, ENSG00000144035
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.