Human TSPAN33/PEN/PEN. ORF/cDNA clone-Lentivirus plasmid (NM_178562)

Cat. No.: pGMLP002594
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TSPAN33/PEN/PEN. Lentiviral expression plasmid for TSPAN33 lentivirus packaging, TSPAN33 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TSPAN33/PEN products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $513
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002594
Gene Name TSPAN33
Accession Number NM_178562
Gene ID 340348
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 852 bp
Gene Alias PEN,PEN.,TSPAN-33
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGCGGAGACCCCGGGCGCCGGCCGCCTCCGGGGAGGAGTTCTCCTTCGTCAGCCCGCTGGTGAAATACCTGCTCTTCTTCTTCAACATGCTCTTCTGGGTGATTTCCATGGTGATGGTGGCTGTGGGTGTCTACGCTCGGCTAATGAAGCATGCAGAAGCAGCCCTAGCCTGCCTGGCAGTGGACCCTGCCATCCTGCTGATCGTGGTGGGTGTCCTCATGTTCCTGCTCACCTTCTGTGGCTGCATTGGGTCCCTCCGCGAGAACATCTGCCTCCTGCAGACGTTCTCCCTCTGCCTCACCGCTGTGTTCCTGCTGCAGCTGGCCGCTGGGATCCTGGGCTTCGTCTTCTCAGACAAGGCTCGAGGGAAAGTGAGTGAGATCATCAACAATGCCATTGTGCACTACCGAGATGACTTGGATCTGCAGAACCTCATTGATTTTGGCCAGAAAAAGTTTAGCTGCTGTGGAGGGATTTCCTACAAGGACTGGTCTCAGAACATGTATTTCAACTGCTCAGAAGACAACCCCAGTCGAGAGCGCTGCTCTGTGCCTTACTCCTGTTGCTTGCCTACTCCTGACCAGGCAGTGATCAACACTATGTGTGGCCAAGGTATGCAGGCCTTTGACTACTTGGAAGCTAGCAAAGTCATCTACACCAATGGCTGTATTGACAAGTTGGTCAACTGGATACACAGCAACCTATTCTTACTTGGTGGTGTGGCTCTAGGCCTGGCCATCCCCCAGCTGGTGGGAATTCTGCTGTCCCAGATCCTAGTGAATCAGATCAAAGATCAGATCAAGCTACAGCTCTACAACCAGCAGCACCGGGCTGACCCATGGTACTGA
ORF Protein Sequence MARRPRAPAASGEEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACLAVDPAILLIVVGVLMFLLTFCGCIGSLRENICLLQTFSLCLTAVFLLQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRADPWY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1884-Ab Anti-TSN33/ TSPAN33/ PEN monoclonal antibody
    Target Antigen GM-Tg-g-MP1884-Ag TSPAN33 VLP (virus-like particle)
    ORF Viral Vector pGMLP002594 Human TSPAN33 Lentivirus plasmid
    ORF Viral Vector vGMLP002594 Human TSPAN33 Lentivirus particle


    Target information

    Target ID GM-MP1884
    Target Name TSPAN33
    Gene Group Identifier
    (Target Gene ID in Homo species)
    340348
    Gene ID 100071801 (Equus caballus), 101083502 (Felis catus), 232670 (Mus musculus), 340348 (Homo sapiens)
    475198 (Canis lupus familiaris), 500065 (Rattus norvegicus), 539284 (Bos taurus), 703028 (Macaca mulatta)
    Gene Symbols & Synonyms TSPAN33,Tspan33,Pen,1300010A20Rik,PEN,PEN.,TSPAN-33,RGD1560915
    Target Alternative Names 1300010A20Rik,PEN,PEN.,Pen,Penumbra (hPen),Proerythroblast new membrane,RGD1560915,TSPAN-33,TSPAN33,Tetraspanin-33,Tspan-33,Tspan33
    Uniprot Accession Q3SYV5,Q86UF1,Q8R3S2
    Additional SwissProt Accessions: Q8R3S2,Q86UF1,Q3SYV5
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000019800, ENSMUSG00000001763, ENSG00000158457, ENSCAFG00845020805, ENSBTAG00000007253, ENSMMUG00000012109
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.