Human TMEM123/KCT3/PORIMIN ORF/cDNA clone-Lentivirus plasmid (NM_052932)

Cat. No.: pGMLP002544
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMEM123/KCT3/PORIMIN Lentiviral expression plasmid for TMEM123 lentivirus packaging, TMEM123 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TMEM123/KCT3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $456.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002544
Gene Name TMEM123
Accession Number NM_052932
Gene ID 114908
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 627 bp
Gene Alias KCT3,PORIMIN,PORMIN
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGACTCGGCGCGCGAGGTGCTTGGGCCGCGCTGCTCCTGGGGACGCTGCAGGTGCTAGCGCTGCTGGGGGCCGCCCATGAAAGCGCAGCCATGGCGGCATCTGCAAACATAGAGAATTCTGGGCTTCCACACAACTCCAGTGCTAACTCAACAGAGACTCTCCAACATGTGCCTTCTGACCATACAAATGAAACTTCCAACAGTACTGTGAAACCACCAACTTCAGTTGCCTCAGACTCCAGTAATACAACGGTCACCACCATGAAACCTACAGCGGCATCTAATACAACAACACCAGGGATGGTCTCAACAAATATGACTTCTACCACCTTAAAGTCTACACCCAAAACAACAAGTGTTTCACAGAACACATCTCAGATATCAACATCCACAATGACCGTAACCCACAATAGTTCAGTGACATCTGCTGCTTCATCAGTAACAATCACAACAACTATGCATTCTGAAGCAAAGAAAGGATCAAAATTTGATACTGGGAGCTTTGTTGGTGGTATTGTATTAACGCTGGGAGTTTTATCTATTCTTTACATTGGATGCAAAATGTATTACTCAAGAAGAGGCATTCGGTATCGAACCATAGATGAACATGATGCCATCATTTAA
ORF Protein Sequence MGLGARGAWAALLLGTLQVLALLGAAHESAAMAASANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTSVSQNTSQISTSTMTVTHNSSVTSAASSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRGIRYRTIDEHDAII

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1966-Ab Anti-TMEM123 monoclonal antibody
    Target Antigen GM-Tg-g-IP1966-Ag TMEM123 protein
    ORF Viral Vector pGMLP002544 Human TMEM123 Lentivirus plasmid
    ORF Viral Vector vGMLP002544 Human TMEM123 Lentivirus particle


    Target information

    Target ID GM-IP1966
    Target Name TMEM123
    Gene Group Identifier
    (Target Gene ID in Homo species)
    114908
    Gene ID 100068925 (Equus caballus), 100300021 (Bos taurus), 100856041 (Canis lupus familiaris), 102902402 (Felis catus)
    114908 (Homo sapiens), 363013 (Rattus norvegicus), 702833 (Macaca mulatta), 71929 (Mus musculus)
    Gene Symbols & Synonyms TMEM123,Tmem123,KCT3,PORMIN,PORIMIN,RGD1305625,2310075C12Rik
    Target Alternative Names 2310075C12Rik,KCT3,Keratinocytes-associated transmembrane protein 3 (KCT-3),PORIMIN,PORMIN,Porimin,Pro-oncosis receptor inducing membrane injury,RGD1305625,TMEM123,Tmem123,Transmembrane protein 123
    Uniprot Accession Q5HZB0,Q8N131,Q91Z22
    Additional SwissProt Accessions: Q8N131,Q5HZB0,Q91Z22
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000033952, ENSCAFG00845001013, ENSG00000152558, ENSMMUG00000003403, ENSMUSG00000050912
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.