Human AK4/AK 4/AK3 ORF/cDNA clone-Lentivirus plasmid (NM_013410)

Cat. No.: pGMLP002502
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human AK4/AK 4/AK3 Lentiviral expression plasmid for AK4 lentivirus packaging, AK4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to AK3L1/AK4/AK4/AK 4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $468
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002502
Gene Name AK4
Accession Number NM_013410
Gene ID 205
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 672 bp
Gene Alias AK 4,AK3,AK3L1,AK3L2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTTCCAAACTCCTGCGCGCGGTCATCCTCGGGCCGCCCGGCTCGGGCAAGGGCACCGTGTGCCAGAGGATCGCCCAGAACTTTGGTCTCCAGCATCTCTCCAGCGGCCACTTCTTGCGGGAGAACATCAAGGCCAGCACCGAAGTTGGTGAGATGGCAAAGCAGTATATAGAGAAAAGTCTTTTGGTTCCAGACCATGTGATCACACGCCTAATGATGTCCGAGTTGGAGAACAGGCGTGGCCAGCACTGGCTCCTTGATGGTTTTCCTAGGACATTAGGACAAGCCGAAGCCCTGGACAAAATCTGTGAAGTGGATCTAGTGATCAGTTTGAATATTCCATTTGAAACACTTAAAGATCGTCTCAGCCGCCGTTGGATTCACCCTCCTAGCGGAAGGGTATATAACCTGGACTTCAATCCACCTCATGTACATGGTATTGATGACGTCACTGGTGAACCGTTAGTCCAGCAGGAGGATGATAAACCCGAAGCAGTTGCTGCCAGGCTAAGACAGTACAAAGACGTGGCAAAGCCAGTCATTGAATTATACAAGAGCCGAGGAGTGCTCCACCAATTTTCCGGAACGGAGACGAACAAAATCTGGCCCTACGTTTACACACTTTTCTCAAACAAGATCACACCTATTCAGTCCAAAGAAGCATATTGA
ORF Protein Sequence MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1556-Ab Anti-KAD4/ AK4/ AK 4 functional antibody
    Target Antigen GM-Tg-g-SE1556-Ag AK4 protein
    ORF Viral Vector pGMLP002502 Human AK4 Lentivirus plasmid
    ORF Viral Vector pGMLP005512 Human AK4 Lentivirus plasmid
    ORF Viral Vector vGMLP002502 Human AK4 Lentivirus particle
    ORF Viral Vector vGMLP005512 Human AK4 Lentivirus particle


    Target information

    Target ID GM-SE1556
    Target Name AK3L1/AK4
    Gene Group Identifier
    （Target Gene ID in Homo species)         		205
    Gene ID 100069665 (Equus caballus), 101084638 (Felis catus), 11639 (Mus musculus), 205 (Homo sapiens)
    29223 (Rattus norvegicus), 489554 (Canis lupus familiaris), 517063 (Bos taurus), 698560 (Macaca mulatta)
    Gene Symbols & Synonyms AK4,Ak4,Ak3,AK 4,Ak-3,Ak-4,Ak3l1,D4Ertd274e,AK3,AK3L1,AK3L2,Ak3l2
    Target Alternative Names AK 4,AK3,AK3L1,AK3L2,AK4,Adenylate kinase 3-like,Adenylate kinase 4,Ak-3,Ak-4,Ak3,Ak3l1,Ak3l2,Ak4,D4Ertd274e,GTP:AMP phosphotransferase AK4,mitochondrial
    Uniprot Accession P27144,Q0VCP1,Q9WUR9,Q9WUS0
    Additional SwissProt Accessions: Q9WUR9,P27144,Q9WUS0,Q0VCP1
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Metabolic pathways
    Gene Ensembl ENSECAG00000018332, ENSMUSG00000028527, ENSG00000162433, ENSCAFG00845029543, ENSMMUG00000053254
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.