Human CD160/BY55/NK1 ORF/cDNA clone-Lentivirus plasmid (NM_007053)

Cat. No.: pGMLP002493
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD160/BY55/NK1 Lentiviral expression plasmid for CD160 lentivirus packaging, CD160 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CD160/BY55 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $436.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002493
Gene Name CD160
Accession Number NM_007053
Gene ID 11126
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 546 bp
Gene Alias BY55,NK1,NK28
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGTTGGAACCCGGCAGAGGCTGCTGTGCCCTGGCCATCCTGCTGGCAATTGTGGACATCCAGTCTGGTGGATGCATTAACATCACCAGCTCAGCTTCCCAGGAAGGAACGCGACTAAACTTAATCTGTACTGTATGGCATAAGAAAGAAGAGGCTGAGGGGTTTGTAGTGTTTTTGTGCAAGGACAGGTCTGGAGACTGTTCTCCTGAGACCAGTTTAAAACAGCTGAGACTTAAAAGGGATCCTGGGATAGATGGTGTTGGTGAAATATCATCTCAGTTGATGTTCACCATAAGCCAAGTCACACCGTTGCACAGTGGGACCTACCAGTGTTGTGCCAGAAGCCAGAAGTCAGGTATCCGCCTTCAGGGCCATTTTTTCTCCATTCTATTCACAGAGACAGGGAACTACACAGTGACGGGATTGAAACAAAGACAACACCTTGAGTTCAGCCATAATGAAGGCACTCTCAGTTCAGGCTTCCTACAAGAAAAGGTCTGGGTAATGCTGGTCACCAGCCTTGTGGCCCTTCAAGCTTTGTAA
ORF Protein Sequence MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T57907-Ab Anti-BY55/ CD160/ NK1 monoclonal antibody
    Target Antigen GM-Tg-g-T57907-Ag CD160 VLP (virus-like particle)
    ORF Viral Vector pGMLP002493 Human CD160 Lentivirus plasmid
    ORF Viral Vector vGMLP002493 Human CD160 Lentivirus particle


    Target information

    Target ID GM-T57907
    Target Name CD160
    Gene Group Identifier
    （Target Gene ID in Homo species)         		11126
    Gene ID 100065657 (Equus caballus), 100125861 (Felis catus), 104971522 (Bos taurus), 11126 (Homo sapiens)
    483158 (Canis lupus familiaris), 502585 (Rattus norvegicus), 54215 (Mus musculus), 696832 (Macaca mulatta)
    Gene Symbols & Synonyms CD160,Cd160,BY55,NK1,NK28,RGD1563598,By55
    Target Alternative Names BY55,By55,CD160,CD160 antigen,Cd160,NK1,NK28,Natural killer cell receptor BY55,RGD1563598
    Uniprot Accession O88875,O95971
    Additional SwissProt Accessions: O95971,O88875
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000010888, ENSG00000117281, ENSCAFG00845010227, ENSMUSG00000038304, ENSMMUG00000007969
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.