Human NDUFC2/B14.5b/CI-B14.5b ORF/cDNA clone-Lentivirus plasmid (NM_004549)
Cat. No.: pGMLP002467
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human NDUFC2/B14.5b/CI-B14.5b Lentiviral expression plasmid for NDUFC2 lentivirus packaging, NDUFC2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
NDUFC2/B14.5b products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP002467 |
| Gene Name | NDUFC2 |
| Accession Number | NM_004549 |
| Gene ID | 4718 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 360 bp |
| Gene Alias | B14.5b,CI-B14.5b,HLC-1,NADHDH2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGATCGCACGGCGGAACCCAGAACCCTTACGGTTTCTGCCGGATGAGGCCCGGAGCCTGCCCCCGCCCAAGCTGACCGACCCGCGGCTCCTCTACATCGGCTTCTTGGGCTACTGCTCCGGCCTGATTGATAACCTAATCCGGCGGAGGCCGATCGCGACGGCTGGTTTGCATCGCCAGCTTCTATATATTACGGCCTTTTTTTTTGCTGGATATTATCTTGTAAAACGTGAAGACTACCTGTATGCTGTGAGGGACCGTGAAATGTTTGGATATATGAAATTACATCCAGAGGATTTTCCTGAAGAAGATAAGAAAACATATGGTGAAATTTTTGAAAAATTCCATCCAATACGTTGA |
| ORF Protein Sequence | MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP0871-Ab | Anti-NDUC2/ NDUFC2/ B14.5b monoclonal antibody |
| Target Antigen | GM-Tg-g-MP0871-Ag | NDUFC2 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP002467 | Human NDUFC2 Lentivirus plasmid |
| ORF Viral Vector | vGMLP002467 | Human NDUFC2 Lentivirus particle |
Target information
| Target ID | GM-MP0871 |
| Target Name | NDUFC2 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
4718 |
| Gene ID |
100426173 (Macaca mulatta), 100630892 (Equus caballus), 101080736 (Felis catus), 293130 (Rattus norvegicus) 338046 (Bos taurus), 4718 (Homo sapiens), 476794 (Canis lupus familiaris), 68197 (Mus musculus) |
| Gene Symbols & Synonyms | NDUFC2,Ndufc2,HLC-1,B14.5b,MC1DN36,NADHDH2,CI-B14.5b,G1,1810004I06Rik,2010300P09Rik |
| Target Alternative Names | 1810004I06Rik,2010300P09Rik,B14.5b,CI-B14.5b,Complex I-B14.5b (CI-B14.5b),G1,HLC-1,Human lung cancer oncogene 1 protein (HLC-1),MC1DN36,NADH dehydrogenase [ubiquinone] 1 subunit C2,NADH-ubiquinone oxidoreductase subunit B14.5b,NADHDH2,NDUFC2,Ndufc2 |
| Uniprot Accession |
O95298,Q02827,Q9CQ54
Additional SwissProt Accessions: Q02827,O95298,Q9CQ54 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | |
| Disease | |
| Disease from KEGG | Metabolic pathways, Alzheimer disease |
| Gene Ensembl | ENSMMUG00000050672, ENSG00000151366, ENSCAFG00845008528, ENSMUSG00000030647 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


