Human UBE2E2/UBCH8 ORF/cDNA clone-Lentivirus plasmid (NM_152653)

Cat. No.: pGMLP002418
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human UBE2E2/UBCH8 Lentiviral expression plasmid for UBE2E2 lentivirus packaging, UBE2E2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to UBE2E2/UBCH8 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $451.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002418
Gene Name UBE2E2
Accession Number NM_152653
Gene ID 7325
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 606 bp
Gene Alias UBCH8
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCCACTGAGGCACAAAGAGTTGATGACAGTCCAAGCACTAGTGGAGGAAGTTCCGATGGAGATCAACGTGAAAGTGTTCAGCAAGAACCAGAAAGAGAACAAGTTCAGCCCAAGAAAAAGGAGGGAAAAATATCCAGCAAAACCGCTGCTAAATTGTCAACTAGTGCTAAAAGAATTCAGAAGGAACTTGCAGAAATCACATTGGACCCTCCTCCCAACTGTAGTGCTGGACCCAAAGGAGACAACATTTATGAATGGAGGTCAACTATATTGGGACCCCCAGGATCTGTCTATGAAGGAGGGGTGTTCTTTCTTGACATTACCTTTTCACCAGACTATCCGTTTAAACCCCCTAAGGTTACCTTCCGAACAAGAATCTATCACTGTAATATTAACAGCCAAGGTGTGATCTGTCTGGACATCTTAAAGGACAACTGGAGTCCGGCTTTAACTATTTCTAAAGTTCTCCTCTCCATCTGCTCACTTCTTACAGATTGCAACCCTGCTGACCCTCTGGTGGGCAGCATCGCCACACAGTACATGACCAACAGAGCAGAGCATGACCGGATGGCCAGACAGTGGACCAAGCGGTACGCCACATAG
ORF Protein Sequence MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T90113-Ab Anti-UBE2E2 monoclonal antibody
    Target Antigen GM-Tg-g-T90113-Ag UBE2E2 protein
    ORF Viral Vector pGMLP002418 Human UBE2E2 Lentivirus plasmid
    ORF Viral Vector vGMLP002418 Human UBE2E2 Lentivirus particle


    Target information

    Target ID GM-T90113
    Target Name UBE2E2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    7325
    Gene ID 218793 (Mus musculus), 361013 (Rattus norvegicus), 699101 (Macaca mulatta), 7325 (Homo sapiens)
    784326 (Bos taurus)
    Gene Symbols & Synonyms Ube2e2,UBE2E2,UBCH8
    Target Alternative Names E2 ubiquitin-conjugating enzyme E2,UBCH8,UBE2E2,UbcH8,Ube2e2,Ubiquitin carrier protein E2,Ubiquitin-conjugating enzyme E2 E2,Ubiquitin-protein ligase E2
    Uniprot Accession Q91W82,Q96LR5
    Additional SwissProt Accessions: Q91W82,Q96LR5
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSMUSG00000058317, ENSMMUG00000013069, ENSG00000182247, ENSBTAG00000047930
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.