Human PPP3R1/CALNB1/CNB ORF/cDNA clone-Lentivirus plasmid (NM_000945)

Cat. No.: pGMLP002414
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PPP3R1/CALNB1/CNB Lentiviral expression plasmid for PPP3R1 lentivirus packaging, PPP3R1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PPP3R1/CALNB1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $428.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002414
Gene Name PPP3R1
Accession Number NM_000945
Gene ID 5534
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 513 bp
Gene Alias CALNB1,CNB,CNB1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGAAATGAGGCAAGTTATCCTTTGGAAATGTGCTCACACTTTGATGCGGATGAAATTAAAAGGCTAGGAAAGAGATTTAAGAAGCTTGATTTGGACAATTCTGGTTCTTTGAGTGTGGAAGAGTTCATGTCTCTGCCTGAGTTACAACAGAATCCTTTAGTACAGCGAGTAATAGATATATTCGACACAGATGGGAATGGAGAAGTAGACTTTAAAGAATTCATTGAGGGCGTCTCTCAGTTCAGTGTCAAAGGAGATAAGGAGCAGAAATTGAGGTTTGCTTTCCGTATCTATGACATGGATAAAGATGGCTATATTTCCAATGGGGAACTCTTCCAGGTATTGAAGATGATGGTGGGGAACAATCTGAAAGATACACAGTTACAGCAAATTGTAGACAAAACCATAATAAATGCAGATAAGGATGGAGATGGAAGAATATCCTTTGAAGAATTCTGTGCTGTTGTAGGTGGCCTAGATATCCACAAAAAGATGGTGGTAGATGTGTGA
ORF Protein Sequence MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2669-Ab Anti-PPP3R1 monoclonal antibody
    Target Antigen GM-Tg-g-IP2669-Ag PPP3R1 protein
    ORF Viral Vector pGMLP002414 Human PPP3R1 Lentivirus plasmid
    ORF Viral Vector vGMLP002414 Human PPP3R1 Lentivirus particle


    Target information

    Target ID GM-IP2669
    Target Name PPP3R1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5534
    Gene ID 100061874 (Equus caballus), 100428682 (Macaca mulatta), 101090344 (Felis catus), 19058 (Mus musculus)
    282321 (Bos taurus), 29748 (Rattus norvegicus), 5534 (Homo sapiens), 612559 (Canis lupus familiaris)
    Gene Symbols & Synonyms PPP3R1,Ppp3r1,Cnb1,CaNB1,MCIP1,CNB,CNB1,CALNB1
    Target Alternative Names CALNB1,CNB,CNB1,CaNB1,Calcineurin subunit B type 1,Cnb1,MCIP1,PPP3R1,Ppp3r1,Protein phosphatase 2B regulatory subunit 1,Protein phosphatase 3 regulatory subunit B alpha isoform 1
    Uniprot Accession P63098,P63099,P63100,Q63810
    Additional SwissProt Accessions: Q63810,P63099,P63100,P63098
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG MAPK signaling pathway, Calcium signaling pathway, cGMP-PKG signaling pathway, Cellular senescence, Wnt signaling pathway, Axon guidance, Osteoclast differentiation, C-type lectin receptor signaling pathway, Natural killer cell mediated cytotoxicity, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, B cell receptor signaling pathway, Long-term potentiation, Glutamatergic synapse, Oxytocin signaling pathway, Renin secretion, Alzheimer disease, Amphetamine addiction, Tuberculosis, Human cytomegalovirus infection, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, PD-L1 expression and PD-1 checkpoint pathway in cancer, Lipid and atherosclerosis
    Gene Ensembl ENSECAG00000009627, ENSMMUG00000046264, ENSMUSG00000033953, ENSBTAG00000010619, ENSG00000221823, ENSCAFG00845022977
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.