Human MAL2 ORF/cDNA clone-Lentivirus plasmid (NM_052886)
Cat. No.: pGMLP002369
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human MAL2/ Lentiviral expression plasmid for MAL2 lentivirus packaging, MAL2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
MAL2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP002369 |
Gene Name | MAL2 |
Accession Number | NM_052886 |
Gene ID | 114569 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 531 bp |
Gene Alias | |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTCGGCCGGCGGAGCGTCAGTCCCGCCGCCCCCGAACCCCGCCGTGTCCTTCCCGCCGCCCCGGGTCACCCTGCCCGCCGGCCCCGACATCCTGCGGACCTACTCGGGCGCCTTCGTCTGCCTGGAGATTCTGTTCGGGGGTCTTGTCTGGATTTTGGTTGCCTCCTCCAATGTTCCTCTACCTCTACTACAAGGATGGGTCATGTTTGTGTCCGTGACAGCGTTTTTCTTTTCGCTCCTCTTTCTGGGCATGTTCCTCTCTGGCATGGTGGCTCAAATTGATGCTAACTGGAACTTCCTGGATTTTGCCTACCATTTTACAGTATTTGTCTTCTATTTTGGAGCCTTTTTATTGGAAGCAGCAGCCACATCCCTGCATGATTTGCATTGCAATACAACCATAACCGGGCAGCCACTCCTGAGTGATAACCAGTATAACATAAACGTAGCAGCCTCAATTTTTGCCTTTATGACGACAGCTTGTTATGGTTGCAGTTTGGGTCTGGCTTTACGAAGATGGCGACCGTAA |
ORF Protein Sequence | MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNFLDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTTACYGCSLGLALRRWRP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1137-Ab | Anti-MAL2 monoclonal antibody |
Target Antigen | GM-Tg-g-IP1137-Ag | MAL2 protein |
ORF Viral Vector | pGMLP002369 | Human MAL2 Lentivirus plasmid |
ORF Viral Vector | vGMLP002369 | Human MAL2 Lentivirus particle |
Target information
Target ID | GM-IP1137 |
Target Name | MAL2 |
Gene Group Identifier (Target Gene ID in Homo species) |
114569 |
Gene ID |
100066039 (Equus caballus), 101081865 (Felis catus), 105853 (Mus musculus), 114569 (Homo sapiens) 362911 (Rattus norvegicus), 511940 (Bos taurus), 608995 (Canis lupus familiaris), 705045 (Macaca mulatta) |
Gene Symbols & Synonyms | MAL2,Mal2 |
Target Alternative Names | MAL2,Protein MAL2 |
Uniprot Accession |
A2VE13,Q8BI08,Q969L2
Additional SwissProt Accessions: Q8BI08,Q969L2,A2VE13 |
Uniprot Entry Name | |
Protein Sub-location | Introcelluar Protein |
Category | |
Disease | |
Disease from KEGG | |
Gene Ensembl | ENSECAG00000022537, ENSMUSG00000024479, ENSG00000147676, ENSBTAG00000011779, ENSCAFG00845005680, ENSMMUG00000004296 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.