Human DNASE1L3/DHP2/DNAS1L3 ORF/cDNA clone-Lentivirus plasmid (NM_004944)

Cat. No.: pGMLP002363
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human DNASE1L3/DHP2/DNAS1L3 Lentiviral expression plasmid for DNASE1L3 lentivirus packaging, DNASE1L3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to DNASE1L3/DHP2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $529.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002363
Gene Name DNASE1L3
Accession Number NM_004944
Gene ID 1776
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 918 bp
Gene Alias DHP2,DNAS1L3,LSD,SLEB16
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCACGGGAGCTGGCCCCACTGCTGCTTCTCCTCCTCTCCATCCACAGCGCCCTGGCCATGAGGATCTGCTCCTTCAACGTCAGGTCCTTTGGGGAAAGCAAGCAGGAAGACAAGAATGCCATGGATGTCATTGTGAAGGTCATCAAACGCTGTGACATCATACTCGTGATGGAAATCAAGGACAGCAACAACAGGATCTGCCCCATACTGATGGAGAAGCTGAACAGAAATTCAAGGAGAGGCATAACGTACAACTATGTGATTAGCTCTCGGCTTGGAAGAAACACATATAAAGAACAATATGCCTTTCTCTACAAGGAAAAGCTGGTGTCTGTGAAGAGGAGTTATCACTACCATGACTATCAGGATGGAGACGCAGATGTGTTTTCCAGGGAGCCCTTTGTGGTCTGGTTCCAATCTCCCCACACTGCTGTCAAAGACTTCGTGATTATCCCCCTGCACACCACCCCAGAGACATCCGTTAAGGAGATCGATGAGTTGGTTGAGGTCTACACGGACGTGAAACACCGCTGGAAGGCGGAGAATTTCATTTTCATGGGTGACTTCAATGCCGGCTGCAGCTACGTCCCCAAGAAGGCCTGGAAGAACATCCGCTTGAGGACTGACCCCAGGTTTGTTTGGCTGATCGGGGACCAAGAGGACACCACGGTGAAGAAGAGCACCAACTGTGCATATGACAGGATTGTGCTTAGAGGACAAGAAATCGTCAGTTCTGTTGTTCCCAAGTCAAACAGTGTTTTTGACTTCCAGAAAGCTTACAAGCTGACTGAAGAGGAGGCCCTGGATGTCAGCGACCACTTTCCAGTTGAATTTAAACTACAGTCTTCAAGGGCCTTCACCAACAGCAAAAAATCTGTCACTCTAAGGAAGAAAACAAAGAGCAAACGCTCCTAG
ORF Protein Sequence MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0893-Ab Anti-DNSL3/ DNASE1L3/ DHP2 functional antibody
    Target Antigen GM-Tg-g-SE0893-Ag DNASE1L3 protein
    ORF Viral Vector pGMLP002363 Human DNASE1L3 Lentivirus plasmid
    ORF Viral Vector pGMLV001380 Human DNASE1L3 Lentivirus plasmid
    ORF Viral Vector pGMPC001849 Human DNASE1L3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002363 Human DNASE1L3 Lentivirus particle
    ORF Viral Vector vGMLV001380 Human DNASE1L3 Lentivirus particle


    Target information

    Target ID GM-SE0893
    Target Name DNASE1L3
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1776
    Gene ID 100057863 (Equus caballus), 101099361 (Felis catus), 116687 (Rattus norvegicus), 13421 (Mus musculus)
    1776 (Homo sapiens), 476576 (Canis lupus familiaris), 512512 (Bos taurus), 702613 (Macaca mulatta)
    Gene Symbols & Synonyms DNASE1L3,Dnase1l3,Lsd,Dhp2,DNasegamma,D3,LSD,DHP2,SLEB16,DNAS1L3
    Target Alternative Names DNASE1L3,Deoxyribonuclease gamma,DNase gamma,DNase I homolog protein DHP2, Deoxyribonuclease I-like 3 (DNase I-like 3), Liver and spleen DNase (LS-DNase, LSD),D3,LSD,DHP2,SLEB16,DNAS1L3
    Uniprot Accession O55070,O89107,Q13609
    Additional SwissProt Accessions: O89107,O55070,Q13609
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000015857, ENSMUSG00000025279, ENSG00000163687, ENSCAFG00845020523, ENSBTAG00000018294, ENSMMUG00000011235
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.