Human CXCL6/CKA-3/GCP-2 ORF/cDNA clone-Lentivirus plasmid (NM_002993)

Cat. No.: pGMLP002324
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CXCL6/CKA-3/GCP-2 Lentiviral expression plasmid for CXCL6 lentivirus packaging, CXCL6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CXCL6/CKA-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002324
Gene Name CXCL6
Accession Number NM_002993
Gene ID 6372
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 345 bp
Gene Alias CKA-3,GCP-2,GCP2,SCYB6
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCCTCCCGTCCAGCCGCGCGGCCCGTGTCCCGGGTCCTTCGGGCTCCTTGTGCGCGCTGCTCGCGCTGCTGCTCCTGCTGACGCCGCCGGGGCCCCTCGCCAGCGCTGGTCCTGTCTCTGCTGTGCTGACAGAGCTGCGTTGCACTTGTTTACGCGTTACGCTGAGAGTAAACCCCAAAACGATTGGTAAACTGCAGGTGTTCCCCGCAGGCCCGCAGTGCTCCAAGGTGGAAGTGGTAGCCTCCCTGAAGAACGGGAAGCAAGTTTGTCTGGACCCGGAAGCCCCTTTTCTAAAGAAAGTCATCCAGAAAATTTTGGACAGTGGAAACAAGAAAAACTGA
ORF Protein Sequence MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0845-Ab Anti-CXCL6/ CKA-3/ GCP-2 functional antibody
    Target Antigen GM-Tg-g-SE0845-Ag CXCL6 protein
    Cytokine cks-Tg-g-GM-SE0845 chemokine (C-X-C motif) ligand 6 (CXCL6) protein & antibody
    ORF Viral Vector pGMLP002324 Human CXCL6 Lentivirus plasmid
    ORF Viral Vector pGMAD001587 Human CXCL6 Adenovirus plasmid
    ORF Viral Vector vGMLP002324 Human CXCL6 Lentivirus particle
    ORF Viral Vector vGMAD001587 Human CXCL6 Adenovirus particle


    Target information

    Target ID GM-SE0845
    Target Name CXCL6
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6372
    Gene ID 100033988 (Equus caballus), 60665 (Rattus norvegicus), 6372 (Homo sapiens), 704133 (Macaca mulatta)
    Gene Symbols & Synonyms CXCL6,Cxcl6,GCP2,Cxcl5,CKA-3,GCP-2,SCYB6
    Target Alternative Names C-X-C motif chemokine 6,CKA-3,CXCL6,Chemokine alpha 3 (CKA-3),Cxcl5,Cxcl6,GCP-2,GCP2,Granulocyte chemotactic protein 2 (GCP-2),SCYB6,Small-inducible cytokine B6
    Uniprot Accession P80162,P97885,Q8MIN2
    Additional SwissProt Accessions: Q8MIN2,P97885,P80162
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, IL-17 signaling pathway, TNF signaling pathway, Pertussis, Rheumatoid arthritis
    Gene Ensembl ENSECAG00000012742, ENSG00000124875, ENSMMUG00000062421
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.