Human IFNL1/IL-29/IL29 ORF/cDNA clone-Lentivirus plasmid (NM_172140)

Cat. No.: pGMLP002306
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IFNL1/IL-29/IL29 Lentiviral expression plasmid for IFNL1 lentivirus packaging, IFNL1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL-29/IFNL1/IL29/IFNL1/IL-29 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002306
Gene Name IFNL1
Accession Number NM_172140
Gene ID 282618
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 603 bp
Gene Alias IL-29,IL29
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCAGCTTGGACCGTGGTGCTGGTGACTTTGGTGCTAGGCTTGGCCGTGGCAGGCCCTGTCCCCACTTCCAAGCCCACCACAACTGGGAAGGGCTGCCACATTGGCAGGTTCAAATCTCTGTCACCACAGGAGCTAGCGAGCTTCAAGAAGGCCAGGGACGCCTTGGAAGAGTCACTCAAGCTGAAAAACTGGAGTTGCAGCTCTCCTGTCTTCCCCGGGAATTGGGACCTGAGGCTTCTCCAGGTGAGGGAGCGCCCTGTGGCCTTGGAGGCTGAGCTGGCCCTGACGCTGAAGGTCCTGGAGGCCGCTGCTGGCCCAGCCCTGGAGGACGTCCTAGACCAGCCCCTTCACACCCTGCACCACATCCTCTCCCAGCTCCAGGCCTGTATCCAGCCTCAGCCCACAGCAGGGCCCAGGCCCCGGGGCCGCCTCCACCACTGGCTGCACCGGCTCCAGGAGGCCCCCAAAAAGGAGTCCGCTGGCTGCCTGGAGGCATCTGTCACCTTCAACCTCTTCCGCCTCCTCACGCGAGACCTCAAATATGTGGCCGATGGGAACCTGTGTCTGAGAACGTCAACCCACCCTGAGTCCACCTGA
ORF Protein Sequence MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T78381-Ab Anti-IFNL1/ IL29/ IL-29 functional antibody
    Target Antigen GM-Tg-g-T78381-Ag IL29/IFNL1 protein
    Cytokine cks-Tg-g-GM-T78381 interferon, lambda 1 (IFNL1) protein & antibody
    ORF Viral Vector pGMLP002306 Human IFNL1 Lentivirus plasmid
    ORF Viral Vector vGMLP002306 Human IFNL1 Lentivirus particle


    Target information

    Target ID GM-T78381
    Target Name IL-29/IFNL1/IL29
    Gene Group Identifier
    （Target Gene ID in Homo species)         		282618
    Gene ID 282618 (Homo sapiens), 612539 (Canis lupus familiaris), 697161 (Macaca mulatta)
    Gene Symbols & Synonyms IFNL1,IL29,IL-29
    Target Alternative Names Cytokine Zcyto21,IFN-lambda-1,IFNL1,IL-29,IL29,Interferon lambda-1,Interleukin-29 (IL-29)
    Uniprot Accession Q8IU54
    Additional SwissProt Accessions: Q8IU54
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway
    Gene Ensembl ENSG00000182393, ENSCAFG00845004732, ENSMMUG00000010866
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.