Human IL22/IL-21/IL-22 ORF/cDNA clone-Lentivirus plasmid (NM_020525)

Cat. No.: pGMLP002305
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL22/IL-21/IL-22 Lentiviral expression plasmid for IL22 lentivirus packaging, IL22 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL-22/IL22/IL22/IL-21 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $435
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002305
Gene Name IL22
Accession Number NM_020525
Gene ID 50616
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 540 bp
Gene Alias IL-21,IL-22,IL-D110,IL-TIF,ILTIF,TIFa,TIFIL-23,zcyto18
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGCCCTGCAGAAATCTGTGAGCTCTTTCCTTATGGGGACCCTGGCCACCAGCTGCCTCCTTCTCTTGGCCCTCTTGGTACAGGGAGGAGCAGCTGCGCCCATCAGCTCCCACTGCAGGCTTGACAAGTCCAACTTCCAGCAGCCCTATATCACCAACCGCACCTTCATGCTGGCTAAGGAGGCTAGCTTGGCTGATAACAACACAGACGTTCGTCTCATTGGGGAGAAACTGTTCCACGGAGTCAGTATGAGTGAGCGCTGCTATCTGATGAAGCAGGTGCTGAACTTCACCCTTGAAGAAGTGCTGTTCCCTCAATCTGATAGGTTCCAGCCTTATATGCAGGAGGTGGTGCCCTTCCTGGCCAGGCTCAGCAACAGGCTAAGCACATGTCATATTGAAGGTGATGACCTGCATATCCAGAGGAATGTGCAAAAGCTGAAGGACACAGTGAAAAAGCTTGGAGAGAGTGGAGAGATCAAAGCAATTGGAGAACTGGATTTGCTGTTTATGTCTCTGAGAAATGCCTGCATTTGA
ORF Protein Sequence MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-209 Pre-Made Fezakinumab biosimilar, Whole mAb, Anti-IL22 Antibody: Anti-IL-21/IL-22/IL-D110/IL-TIF/ILTIF/TIFIL-23/TIFa/zcyto18 therapeutic antibody
    Target Antibody GM-Tg-g-T44682-Ab Anti-IL22/ IL-21/ IL-22 functional antibody
    Target Antigen GM-Tg-g-T44682-Ag IL22 protein
    Cytokine cks-Tg-g-GM-T44682 Interleukin 22 (IL22) protein & antibody
    ORF Viral Vector pGMLP002305 Human IL22 Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-029 Human IL22 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-112 Human IL22 Adenovirus plasmid
    ORF Viral Vector vGMLP002305 Human IL22 Lentivirus particle
    ORF Viral Vector vGMLP-IL-029 Human IL22 Lentivirus particle
    ORF Viral Vector vGMAP-IL-112 Human IL22 Adenovirus particle


    Target information

    Target ID GM-T44682
    Target Name IL-22/IL22
    Gene Group Identifier
    （Target Gene ID in Homo species)         		50616
    Gene ID 100058976 (Equus caballus), 101095184 (Felis catus), 481153 (Canis lupus familiaris), 500836 (Rattus norvegicus)
    50616 (Homo sapiens), 507778 (Bos taurus), 718047 (Macaca mulatta)
    Gene Symbols & Synonyms IL22,Il22,IF2B1,If2b1,RGD1561292,TIFa,IL-21,IL-22,ILTIF,IL-TIF,IL-D110,zcyto18,TIFIL-23
    Target Alternative Names Cytokine Zcyto18,IF2B1,IL-10-related T-cell-derived-inducible factor (IL-TIF),IL-21,IL-22,IL-D110,IL-TIF,IL22,ILTIF,If2b1,Il22,Interleukin-22,RGD1561292,TIFIL-23,TIFa,zcyto18
    Uniprot Accession Q9GZX6
    Additional SwissProt Accessions: Q9GZX6
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway, Th17 cell differentiation, Inflammatory bowel disease
    Gene Ensembl ENSECAG00000019526, ENSCAFG00845013728, ENSG00000127318, ENSBTAG00000015407, ENSMMUG00000018724
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.