Human PPBP/B-TG1/Beta-TG ORF/cDNA clone-Lentivirus plasmid (NM_002704)

Cat. No.: pGMLP002272
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PPBP/B-TG1/Beta-TG Lentiviral expression plasmid for PPBP lentivirus packaging, PPBP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to NAP2/PPBP/PPBP/B-TG1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002272
Gene Name PPBP
Accession Number NM_002704
Gene ID 5473
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 387 bp
Gene Alias B-TG1,Beta-TG,CTAP-III,CTAP3,CTAPIII,CXCL7,LA-PF4,LDGF,MDGF,NAP-2,PBP,SCYB7,TC1,TC2,TGB,TGB1,THBGB,THBGB1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCCTCAGACTTGATACCACCCCTTCCTGTAACAGTGCGAGACCACTTCATGCCTTGCAGGTGCTGCTGCTTCTGTCATTGCTGCTGACTGCTCTGGCTTCCTCCACCAAAGGACAAACTAAGAGAAACTTGGCGAAAGGCAAAGAGGAAAGTCTAGACAGTGACTTGTATGCTGAACTCCGCTGCATGTGTATAAAGACAACCTCTGGAATTCATCCCAAAAACATCCAAAGTTTGGAAGTGATCGGGAAAGGAACCCATTGCAACCAAGTCGAAGTGATAGCCACACTGAAGGATGGGAGGAAAATCTGCCTGGACCCAGATGCTCCCAGAATCAAGAAAATTGTACAGAAAAAATTGGCAGGTGATGAATCTGCTGATTAA
ORF Protein Sequence MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0421-Ab Anti-CXCL7/ PPBP/ B-TG1 functional antibody
    Target Antigen GM-Tg-g-SE0421-Ag PPBP protein
    Cytokine cks-Tg-g-GM-SE0421 pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) (PPBP) protein & antibody
    ORF Viral Vector pGMLP002272 Human PPBP Lentivirus plasmid
    ORF Viral Vector vGMLP002272 Human PPBP Lentivirus particle


    Target information

    Target ID GM-SE0421
    Target Name NAP2/PPBP
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5473
    Gene ID 100055973 (Equus caballus), 101094344 (Felis catus), 5473 (Homo sapiens), 613723 (Bos taurus)
    703334 (Macaca mulatta)
    Gene Symbols & Synonyms PPBP,PBP,TC1,TC2,TGB,LDGF,MDGF,TGB1,B-TG1,CTAP3,CXCL7,NAP-2,SCYB7,THBGB,LA-PF4,THBGB1,Beta-TG,CTAPIII,CTAP-III
    Target Alternative Names B-TG1,Beta-TG,C-X-C motif chemokine 7,CTAP-III,CTAP3,CTAPIII,CXCL7,LA-PF4,LDGF,Leukocyte-derived growth factor (LDGF),MDGF,Macrophage-derived growth factor (MDGF),NAP-2,NAP2,PBP,PPBP,Platelet basic protein,SCYB7,Small-inducible cytokine B7,TC1,TC2,TGB,TGB1,THBGB,THBGB1
    Uniprot Accession P02775
    Additional SwissProt Accessions: P02775
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease Ovary Cancer, Sepsis, Dent disease, Diabetes type-2
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway
    Gene Ensembl ENSECAG00000012702, ENSG00000163736, ENSBTAG00000011961, ENSMMUG00000042371
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.