Human EPO/EP/MVCD2 ORF/cDNA clone-Lentivirus plasmid (NM_000799.3)
Cat. No.: pGMLP002230
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human EPO/EP/MVCD2 Lentiviral expression plasmid for EPO lentivirus packaging, EPO lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
EPO/Erythropoietin/EPO/EP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP002230 |
| Gene Name | EPO |
| Accession Number | NM_000799.3 |
| Gene ID | 2056 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 582 bp |
| Gene Alias | EP,MVCD2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGGGGTGCACGAATGTCCTGCCTGGCTGTGGCTTCTCCTGTCCCTGCTGTCGCTCCCTCTGGGCCTCCCAGTCCTGGGCGCCCCACCACGCCTCATCTGTGACAGCCGAGTCCTGGAGAGGTACCTCTTGGAGGCCAAGGAGGCCGAGAATATCACGACGGGCTGTGCTGAACACTGCAGCTTGAATGAGAATATCACTGTCCCAGACACCAAAGTTAATTTCTATGCCTGGAAGAGGATGGAGGTCGGGCAGCAGGCCGTAGAAGTCTGGCAGGGCCTGGCCCTGCTGTCGGAAGCTGTCCTGCGGGGCCAGGCCCTGTTGGTCAACTCTTCCCAGCCGTGGGAGCCCCTGCAGCTGCATGTGGATAAAGCCGTCAGTGGCCTTCGCAGCCTCACCACTCTGCTTCGGGCTCTGGGAGCCCAGAAGGAAGCCATCTCCCCTCCAGATGCGGCCTCAGCTGCTCCACTCCGAACAATCACTGCTGACACTTTCCGCAAACTCTTCCGAGTCTACTCCAATTTCCTCCGGGGAAAGCTGAAGCTGTACACAGGGGAGGCCTGCAGGACAGGGGACAGATGA |
| ORF Protein Sequence | MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T07958-Ab | Anti-EPO/ DBAL/ ECYT5 functional antibody |
| Target Antigen | GM-Tg-g-T07958-Ag | EPO protein |
| ORF Viral Vector | pGMLP002230 | Human EPO Lentivirus plasmid |
| ORF Viral Vector | pGMPC004899 | Human EPO Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP002230 | Human EPO Lentivirus particle |
Target information
| Target ID | GM-T07958 |
| Target Name | EPO/Erythropoietin |
|
Gene Group Identifier (Target Gene ID in Homo species) |
2056 |
| Gene ID |
100033849 (Equus caballus), 13856 (Mus musculus), 2056 (Homo sapiens), 24335 (Rattus norvegicus) 280784 (Bos taurus), 404002 (Canis lupus familiaris), 493801 (Felis catus), 719294 (Macaca mulatta) |
| Gene Symbols & Synonyms | EPO,Epo,EP,DBAL,ECYT5,MVCD2 |
| Target Alternative Names | DBAL,ECYT5,EP,EPO,Epo,Erythropoietin,MVCD2 |
| Uniprot Accession |
P01588,P07321,P29676,P33707,P33708,P48617,Q28513,Q867B1
Additional SwissProt Accessions: Q867B1,P07321,P01588,P29676,P48617,P33707,P33708,Q28513 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Diagnostics Biomarker |
| Disease | Asthma, prolonged cough, lung function assessment, Eosinophilic airway inflammation, breast cancer, Sepsis |
| Disease from KEGG | Cytokine-cytokine receptor interaction, HIF-1 signaling pathway, PI3K-Akt signaling pathway, JAK-STAT signaling pathway, Hematopoietic cell lineage, Pathways in cancer |
| Gene Ensembl | ENSECAG00000010733, ENSMUSG00000029711, ENSG00000130427, ENSBTAG00000003430, ENSCAFG00845001075, ENSMMUG00000022863 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


