Human TAGLN/SM22/SM22-alpha ORF/cDNA clone-Lentivirus plasmid (NM_003186)

Cat. No.: pGMLP002197
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TAGLN/SM22/SM22-alpha Lentiviral expression plasmid for TAGLN lentivirus packaging, TAGLN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to transgelin/TAGLN/TAGLN/SM22 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $451.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002197
Gene Name TAGLN
Accession Number NM_003186
Gene ID 6876
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 606 bp
Gene Alias SM22,SM22-alpha,SMCC,TAGLN1,WS3-10
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCAACAAGGGTCCTTCCTATGGCATGAGCCGCGAAGTGCAGTCCAAAATCGAGAAGAAGTATGACGAGGAGCTGGAGGAGCGGCTGGTGGAGTGGATCATAGTGCAGTGTGGCCCTGATGTGGGCCGCCCAGACCGTGGGCGCTTGGGCTTCCAGGTCTGGCTGAAGAATGGCGTGATTCTGAGCAAGCTGGTGAACAGCCTGTACCCTGATGGCTCCAAGCCGGTGAAGGTGCCCGAGAACCCACCCTCCATGGTCTTCAAGCAGATGGAGCAGGTGGCTCAGTTCCTGAAGGCGGCTGAGGACTATGGGGTCATCAAGACTGACATGTTCCAGACTGTTGACCTCTTTGAAGGCAAAGACATGGCAGCAGTGCAGAGGACCCTGATGGCTTTGGGCAGCTTGGCAGTGACCAAGAATGATGGGCACTACCGTGGAGATCCCAACTGGTTTATGAAGAAAGCGCAGGAGCATAAGAGGGAATTCACAGAGAGCCAGCTGCAGGAGGGAAAGCATGTCATTGGCCTTCAGATGGGCAGCAACAGAGGGGCCTCCCAGGCCGGCATGACAGGCTACGGACGACCTCGGCAGATCATCAGTTAG
ORF Protein Sequence MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T93292-Ab Anti-TAGLN monoclonal antibody
    Target Antigen GM-Tg-g-T93292-Ag TAGLN protein
    ORF Viral Vector pGMLP002197 Human TAGLN Lentivirus plasmid
    ORF Viral Vector vGMLP002197 Human TAGLN Lentivirus particle


    Target information

    Target ID GM-T93292
    Target Name transgelin/TAGLN
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6876
    Gene ID 100062690 (Equus caballus), 101085916 (Felis catus), 106993487 (Macaca mulatta), 21345 (Mus musculus)
    25123 (Rattus norvegicus), 479424 (Canis lupus familiaris), 513463 (Bos taurus), 6876 (Homo sapiens)
    Gene Symbols & Synonyms TAGLN,Tagln,Sm22,Sm22a,Ws310,SM22,SMCC,TGLN,TAGLN1,WS3-10,SM22-alpha
    Target Alternative Names transgelin, TAGLN,Transgelin,22 kDa actin-binding protein, Protein WS3-10, Smooth muscle protein 22-alpha (SM22-alpha),SM22,SMCC,TGLN,TAGLN1,WS3-10,SM22-alpha
    Uniprot Accession P31232,P37804,Q01995,Q9TS87
    Additional SwissProt Accessions: P37804,P31232,Q9TS87,Q01995
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSMMUG00000002058, ENSMUSG00000032085, ENSBTAG00000007196, ENSG00000149591
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.