Human RSPO3/CRISTIN1/PWTSR ORF/cDNA clone-Lentivirus plasmid (NM_032784)

Cat. No.: pGMLP002184
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RSPO3/CRISTIN1/PWTSR Lentiviral expression plasmid for RSPO3 lentivirus packaging, RSPO3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RSPO3/CRISTIN1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $504.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002184
Gene Name RSPO3
Accession Number NM_032784
Gene ID 84870
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 819 bp
Gene Alias CRISTIN1,PWTSR,THSD2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCACTTGCGACTGATTTCTTGGCTTTTTATCATTTTGAACTTTATGGAATACATCGGCAGCCAAAACGCCTCCCGGGGAAGGCGCCAGCGAAGAATGCATCCTAACGTTAGTCAAGGCTGCCAAGGAGGCTGTGCAACATGCTCAGATTACAATGGATGTTTGTCATGTAAGCCCAGACTATTTTTTGCTCTGGAAAGAATTGGCATGAAGCAGATTGGAGTATGTCTCTCTTCATGTCCAAGTGGATATTATGGAACTCGATATCCAGATATAAATAAGTGTACAAAATGCAAAGCTGACTGTGATACCTGTTTCAACAAAAATTTCTGCACAAAATGTAAAAGTGGATTTTACTTACACCTTGGAAAGTGCCTTGACAATTGCCCAGAAGGGTTGGAAGCCAACAACCATACTATGGAGTGTGTCAGTATTGTGCACTGTGAGGTCAGTGAATGGAATCCTTGGAGTCCATGCACGAAGAAGGGAAAAACATGTGGCTTCAAAAGAGGGACTGAAACACGGGTCCGAGAAATAATACAGCATCCTTCAGCAAAGGGTAACCTGTGTCCCCCAACAAATGAGACAAGAAAGTGTACAGTGCAAAGGAAGAAGTGTCAGAAGGGAGAACGAGGAAAAAAAGGAAGGGAGAGGAAAAGAAAAAAACCTAATAAAGGAGAAAGTAAAGAAGCAATACCTGACAGCAAAAGTCTGGAATCCAGCAAAGAAATCCCAGAGCAACGAGAAAACAAACAGCAGCAGAAGAAGCGAAAAGTCCAAGATAAACAGAAATCGGTATCAGTCAGCACTGTACACTAG
ORF Protein Sequence MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-495 Pre-Made Rosmantuzumab biosimilar, Whole mAb, Anti-RSPO3 Antibody: Anti-CRISTIN1/PWTSR/THSD2 therapeutic antibody
    Target Antibody GM-Tg-g-T79162-Ab Anti-RSPO3/ CRISTIN1/ PWTSR functional antibody
    Target Antigen GM-Tg-g-T79162-Ag RSPO3 protein
    ORF Viral Vector pGMLP002184 Human RSPO3 Lentivirus plasmid
    ORF Viral Vector vGMLP002184 Human RSPO3 Lentivirus particle


    Target information

    Target ID GM-T79162
    Target Name RSPO3
    Gene Group Identifier
    (Target Gene ID in Homo species)
    84870
    Gene ID 100067377 (Equus caballus), 101085635 (Felis catus), 476287 (Canis lupus familiaris), 498997 (Rattus norvegicus)
    534650 (Bos taurus), 712288 (Macaca mulatta), 72780 (Mus musculus), 84870 (Homo sapiens)
    Gene Symbols & Synonyms RSPO3,Rspo3,RGD1563246,Thsd2,Cristin1,2810459H04Rik,PWTSR,THSD2,CRISTIN1
    Target Alternative Names RSPO3,R-spondin-3,Protein with TSP type-1 repeat (hPWTSR), Roof plate-specific spondin-3 (hRspo3), Thrombospondin type-1 domain-containing protein 2,PWTSR,THSD2,CRISTIN1
    Uniprot Accession Q1RMU1,Q2TJ95,Q9BXY4
    Additional SwissProt Accessions: Q1RMU1,Q2TJ95,Q9BXY4
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index
    Disease
    Disease from KEGG Wnt signaling pathway
    Gene Ensembl ENSECAG00000020203, ENSBTAG00000008121, ENSMMUG00000015355, ENSMUSG00000019880, ENSG00000146374
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.