Human ID2/bHLHb26/GIG8 ORF/cDNA clone-Lentivirus plasmid (NM_002166)

Cat. No.: pGMLP002123
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ID2/bHLHb26/GIG8 Lentiviral expression plasmid for ID2 lentivirus packaging, ID2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ID2/bHLHb26 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002123
Gene Name ID2
Accession Number NM_002166
Gene ID 3398
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 405 bp
Gene Alias bHLHb26,GIG8,ID2A,ID2H
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAAGCCTTCAGTCCCGTGAGGTCCGTTAGGAAAAACAGCCTGTCGGACCACAGCCTGGGCATCTCCCGGAGCAAAACCCCTGTGGACGACCCGATGAGCCTGCTATACAACATGAACGACTGCTACTCCAAGCTCAAGGAGCTGGTGCCCAGCATCCCCCAGAACAAGAAGGTGAGCAAGATGGAAATCCTGCAGCACGTCATCGACTACATCTTGGACCTGCAGATCGCCCTGGACTCGCATCCCACTATTGTCAGCCTGCATCACCAGAGACCCGGGCAGAACCAGGCGTCCAGGACGCCGCTGACCACCCTCAACACGGATATCAGCATCCTGTCCTTGCAGGCTTCTGAATTCCCTTCTGAGTTAATGTCAAATGACAGCAAAGCACTGTGTGGCTGA
ORF Protein Sequence MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T68877-Ab Anti-ID2 monoclonal antibody
    Target Antigen GM-Tg-g-T68877-Ag ID2 protein
    ORF Viral Vector pGMLP002123 Human ID2 Lentivirus plasmid
    ORF Viral Vector vGMLP002123 Human ID2 Lentivirus particle


    Target information

    Target ID GM-T68877
    Target Name ID2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3398
    Gene ID 100057240 (Equus caballus), 100686903 (Canis lupus familiaris), 101090256 (Felis catus), 15902 (Mus musculus)
    25587 (Rattus norvegicus), 3398 (Homo sapiens), 505025 (Bos taurus), 693394 (Macaca mulatta)
    Gene Symbols & Synonyms ID2,Id2,Idb2,bHLHb26,Ac2-300,GIG8,ID2A,ID2H
    Target Alternative Names Ac2-300,Class B basic helix-loop-helix protein 26 (bHLHb26),DNA-binding protein inhibitor ID-2,GIG8,ID2,ID2A,ID2H,Id2,Idb2,Inhibitor of DNA binding 2,Inhibitor of differentiation 2,bHLHb26
    Uniprot Accession P41136,P41137,Q02363,Q3ZC46
    Additional SwissProt Accessions: P41136,P41137,Q02363,Q3ZC46
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG TGF-beta signaling pathway, Hippo signaling pathway, Signaling pathways regulating pluripotency of stem cells
    Gene Ensembl ENSMUSG00000020644, ENSG00000115738, ENSBTAG00000021187, ENSMMUG00000003237
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.