Human ICAM4/CD242/LW ORF/cDNA clone-Lentivirus plasmid (NM_001039132)

Cat. No.: pGMLP002121
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ICAM4/CD242/LW Lentiviral expression plasmid for ICAM4 lentivirus packaging, ICAM4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ICAM4/CD242/ICAM4/CD242 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $504.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002121
Gene Name ICAM4
Accession Number NM_001039132
Gene ID 3386
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 819 bp
Gene Alias CD242,LW
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGTCTCTGTTCCCTCTGTCGCTGCTGTTTTTTTTGGCGGCCGCCTACCCGGGAGTTGGGAGCGCGCTGGGACGCCGGACTAAGCGGGCGCAAAGCCCCAAGGGTAGCCCTCTCGCGCCCTCCGGGACCTCAGTGCCCTTCTGGGTGCGCATGAGCCCGGAGTTCGTGGCTGTGCAGCCGGGGAAGTCAGTGCAGCTCAATTGCAGCAACAGCTGTCCCCAGCCGCAGAATTCCAGCCTCCGCACCCCGCTGCGGCAAGGCAAGACGCTCAGAGGGCCGGGTTGGGTGTCTTACCAGCTGCTCGACGTGAGGGCCTGGAGCTCCCTCGCGCACTGCCTCGTGACCTGCGCAGGAAAAACACGCTGGGCCACCTCCAGGATCACCGCCTACAGTGTTCCCGGTGGGCTACTTGGTGGTGACCCTGAGGCATGGAAGCCGGGTCATCTATTCCGAAAGCCTGGAGCGCTTCACCGGCCTGGATCTGGCCAACGTGACCTTGACCTACGAGTTTGCTGCTGGACCCCGCGACTTCTGGCAGCCCGTGATCTGCCACGCGCGCCTCAATCTCGACGGCCTGGTGGTCCGCAACAGCTCGGCACCCATTACACTGATGCTCGCTTGGAGCCCCGCGCCCACAGCTTTGGCCTCCGGTTCCATCGCTGCCCTTGTAGGGATCCTCCTCACTGTGGGCGCTGCGTACCTATGCAAGTGCCTAGCTATGAAGTCCCAGGCGTAAAGGGGGATGTTCTATGCCGGCTGAGCGAGAAAAAGAGGAATATGAAACAATCTGGGGAAATGGCCATACATGGTGGCTGA
ORF Protein Sequence MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGGDPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEPRAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLSEKKRNMKQSGEMAIHGG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0599-Ab Anti-ICAM4/ CD242/ LW monoclonal antibody
    Target Antigen GM-Tg-g-MP0599-Ag ICAM4 VLP (virus-like particle)
    ORF Viral Vector pGMLP002121 Human ICAM4 Lentivirus plasmid
    ORF Viral Vector vGMLP002121 Human ICAM4 Lentivirus particle


    Target information

    Target ID GM-MP0599
    Target Name ICAM4/CD242
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3386
    Gene ID 100055305 (Equus caballus), 101093754 (Felis catus), 298702 (Rattus norvegicus), 3386 (Homo sapiens)
    514873 (Bos taurus), 712354 (Macaca mulatta), 78369 (Mus musculus)
    Gene Symbols & Synonyms ICAM4,Icam4,LW,CD242,Cd242,ICAM-4,1810015M19Rik
    Target Alternative Names ICAM4, CD242,Intercellular adhesion molecule 4,ICAM-4,Landsteiner-Wiener blood group glycoprotein (LW blood group protein),LW,CD242
    Uniprot Accession Q14773,Q9ERM2
    Additional SwissProt Accessions: Q14773,Q9ERM2
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000012805, ENSG00000105371, ENSMMUG00000009343, ENSMUSG00000001014
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.