Human FABP1/FABPL/L-FABP ORF/cDNA clone-Lentivirus plasmid (NM_001443)

Cat. No.: pGMLP002096
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FABP1/FABPL/L-FABP Lentiviral expression plasmid for FABP1 lentivirus packaging, FABP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FABP1/FABPL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002096
Gene Name FABP1
Accession Number NM_001443
Gene ID 2168
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 384 bp
Gene Alias FABPL,L-FABP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGTTTCTCCGGCAAGTACCAACTGCAGAGCCAGGAAAACTTTGAAGCCTTCATGAAGGCAATCGGTCTGCCGGAAGAGCTCATCCAGAAGGGGAAGGATATCAAGGGGGTGTCGGAAATCGTGCAGAATGGGAAGCACTTCAAGTTCACCATCACCGCTGGGTCCAAAGTGATCCAAAACGAATTCACGGTGGGGGAGGAATGTGAGCTGGAGACAATGACAGGGGAGAAAGTCAAGACAGTGGTTCAGTTGGAAGGTGACAATAAACTGGTGACAACTTTCAAAAACATCAAGTCTGTGACCGAACTCAACGGCGACATAATCACCAATACCATGACATTGGGTGACATTGTCTTCAAGAGAATCAGCAAGAGAATTTAA
ORF Protein Sequence MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T73712-Ab Anti-FABP1 monoclonal antibody
    Target Antigen GM-Tg-g-T73712-Ag FABP1 protein
    ORF Viral Vector pGMLP002096 Human FABP1 Lentivirus plasmid
    ORF Viral Vector pGMPC004797 Human FABP1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002096 Human FABP1 Lentivirus particle


    Target information

    Target ID GM-T73712
    Target Name FABP1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		2168
    Gene ID 100052746 (Equus caballus), 101095488 (Felis catus), 14080 (Mus musculus), 2168 (Homo sapiens)
    24360 (Rattus norvegicus), 327700 (Bos taurus), 403619 (Canis lupus familiaris), 699776 (Macaca mulatta)
    Gene Symbols & Synonyms FABP1,Fabp1,Fabpl,L-FABP,FABPL,SCP,p14,SCP.,Fabplg,FABP
    Target Alternative Names FABP,FABP1,FABPL,Fabp1,Fabpl,Fabplg,Fatty acid-binding protein,Fatty acid-binding protein 1,L-FABP,Liver-type fatty acid-binding protein (L-FABP),SCP,SCP.,liver,p14
    Uniprot Accession P02692,P07148,P12710,P80425
    Additional SwissProt Accessions: P12710,P07148,P02692,P80425
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Injury to Kidney, Acute kidney failure, Chronic Kidney Disease, Chronic nephritic syndrome, Complications of kidney transplant, Contrast - Induced Nephropathy, Coronary artery disease, Delayed Graft Function, Other diseases of intestines (K55-K64), Other obstructive and reflux uropathy, Tubulo-interstitial nephropathy in systemic lupus erythematosus, Type 1 diabetes mellitus, Type 2 diabetes mellitus with diabetic chronic kidney disease, Type 2 diabetes mellitus with diabetic nephropathy, Diabetes mellitus
    Disease from KEGG PPAR signaling pathway, Alcoholic liver disease, Fat digestion and absorption
    Gene Ensembl ENSECAG00000015990, ENSMUSG00000054422, ENSG00000163586, ENSBTAG00000018054, ENSCAFG00845013057, ENSMMUG00000042446
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.