Human CSN2/CASB ORF/cDNA clone-Lentivirus plasmid (NM_001891)

Cat. No.: pGMLP002067
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CSN2/CASB Lentiviral expression plasmid for CSN2 lentivirus packaging, CSN2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CSN2/CASB products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $470.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002067
Gene Name CSN2
Accession Number NM_001891
Gene ID 1447
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 681 bp
Gene Alias CASB
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGGTCCTCATCCTCGCCTGCCTGGTGGCTCTTGCTCTTGCAAGGGAGACCATAGAAAGCCTTTCAAGCAGTGAGGAATCTATTACAGAATACAAGCAGAAAGTTGAGAAGGTTAAACATGAGGACCAGCAGCAAGGAGAGGATGAACACCAGGATAAAATCTACCCCTCTTTCCAGCCACAGCCTCTGATCTATCCATTCGTTGAACCTATCCCCTATGGTTTTCTTCCACAAAACATTCTGCCTCTTGCTCAGCCTGCTGTGGTGCTGCCTGTCCCTCAGCCTGAAATAATGGAAGTCCCTAAAGCTAAAGACACTGTCTACACTAAGGGCAGAGTGATGCCTGTCCTTAAATCTCCAACGATACCCTTTTTTGACCCTCAAATCCCAAAACTCACTGATCTTGAAAATCTGCATCTTCCTCTGCCTCTGCTCCAGCCCTTGATGCAGCAGGTCCCTCAGCCTATTCCTCAGACTCTTGCACTTCCCCCTCAGCCCCTGTGGTCTGTTCCTCAGCCCAAAGTCCTGCCTATCCCCCAGCAAGTGGTGCCCTACCCTCAGAGAGCTGTGCCTGTTCAAGCCCTTCTGCTCAACCAAGAACTTCTACTTAACCCCACCCACCAGATCTACCCTGTGACTCAGCCACTTGCCCCAGTTCATAACCCCATTAGTGTCTAA
ORF Protein Sequence MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0830-Ab Anti-CASB/ CSN2 functional antibody
    Target Antigen GM-Tg-g-SE0830-Ag CSN2 protein
    ORF Viral Vector pGMLP002067 Human CSN2 Lentivirus plasmid
    ORF Viral Vector vGMLP002067 Human CSN2 Lentivirus particle


    Target information

    Target ID GM-SE0830
    Target Name CSN2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1447
    Gene ID 100033903 (Equus caballus), 101098299 (Felis catus), 12991 (Mus musculus), 1447 (Homo sapiens)
    281099 (Bos taurus), 29173 (Rattus norvegicus), 403644 (Canis lupus familiaris), 707520 (Macaca mulatta)
    Gene Symbols & Synonyms CSN2,Csn2,Csnb,CASB,PDC213
    Target Alternative Names CSN2,Beta-casein,CASB,PDC213
    Uniprot Accession P02665,P02666,P05814,P10598,Q9GKK3
    Additional SwissProt Accessions: Q9GKK3,P10598,P05814,P02666,P02665
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Prolactin signaling pathway
    Gene Ensembl ENSECAG00000009837, ENSMUSG00000063157, ENSG00000135222, ENSBTAG00000002632, ENSCAFG00845010297, ENSMMUG00000004849
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.