Human CCL21/6Ckine/CKb9 ORF/cDNA clone-Lentivirus plasmid (NM_002989)

Cat. No.: pGMLP002050
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCL21/6Ckine/CKb9 Lentiviral expression plasmid for CCL21 lentivirus packaging, CCL21 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CCL21/6Ckine products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002050
Gene Name CCL21
Accession Number NM_002989
Gene ID 6366
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 405 bp
Gene Alias 6Ckine,CKb9,ECL,SCYA21,SLC,TCA4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCAGTCACTGGCTCTGAGCCTCCTTATCCTGGTTCTGGCCTTTGGCATCCCCAGGACCCAAGGCAGTGATGGAGGGGCTCAGGACTGTTGCCTCAAGTACAGCCAAAGGAAGATTCCCGCCAAGGTTGTCCGCAGCTACCGGAAGCAGGAACCAAGCTTAGGCTGCTCCATCCCAGCTATCCTGTTCTTGCCCCGCAAGCGCTCTCAGGCAGAGCTATGTGCAGACCCAAAGGAGCTCTGGGTGCAGCAGCTGATGCAGCATCTGGACAAGACACCATCCCCACAGAAACCAGCCCAGGGCTGCAGGAAGGACAGGGGGGCCTCCAAGACTGGCAAGAAAGGAAAGGGCTCCAAAGGCTGCAAGAGGACTGAGCGGTCACAGACCCCTAAAGGGCCATAG
ORF Protein Sequence MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T93237-Ab Anti-CCL21/ 6Ckine/ CKb9 functional antibody
    Target Antigen GM-Tg-g-T93237-Ag CCL21 protein
    Cytokine cks-Tg-g-GM-T93237 chemokine (C-C motif) ligand 21 (CCL21) protein & antibody
    ORF Viral Vector pGMLP002050 Human CCL21 Lentivirus plasmid
    ORF Viral Vector vGMLP002050 Human CCL21 Lentivirus particle


    Target information

    Target ID GM-T93237
    Target Name CCL21
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6366
    Gene ID 101087275 (Felis catus), 18829 (Mus musculus), 298006 (Rattus norvegicus), 448796 (Canis lupus familiaris)
    511112 (Bos taurus), 574183 (Macaca mulatta), 6366 (Homo sapiens)
    Gene Symbols & Synonyms CCL21,Ccl21a,Ccl21,ALP,SLC,plt,CKb9,Tca4,6Ckine,Gm1987,Scya21,6CKBAC2,SCYA21a,Scya21b,Ccl21b,ECL,TCA4,SCYA21
    Target Alternative Names 6CKBAC2,6Ckine,ALP,Beta-chemokine exodus-2,C-C motif chemokine 21,CCL21,CKb9,Ccl21,Ccl21a,Ccl21b,ECL,Gm1987,SCYA21,SCYA21a,SLC,Scya21,Scya21b,Secondary lymphoid-tissue chemokine (SLC),Small-inducible cytokine A21,TCA4,Tca4,plt
    Uniprot Accession O00585,P84444,Q8HYP5
    Additional SwissProt Accessions: P84444,Q8HYP5,O00585
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease cancer, ovarian cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, NF-kappa B signaling pathway
    Gene Ensembl ENSMUSG00000094686, ENSCAFG00845005361, ENSBTAG00000010161, ENSMMUG00000063081, ENSG00000137077
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.