Human CCL21/6Ckine/CKb9 ORF/cDNA clone-Lentivirus plasmid (NM_002989)
Cat. No.: pGMLP002050
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CCL21/6Ckine/CKb9 Lentiviral expression plasmid for CCL21 lentivirus packaging, CCL21 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CCL21/6Ckine products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP002050 |
| Gene Name | CCL21 |
| Accession Number | NM_002989 |
| Gene ID | 6366 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 405 bp |
| Gene Alias | 6Ckine,CKb9,ECL,SCYA21,SLC,TCA4 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCTCAGTCACTGGCTCTGAGCCTCCTTATCCTGGTTCTGGCCTTTGGCATCCCCAGGACCCAAGGCAGTGATGGAGGGGCTCAGGACTGTTGCCTCAAGTACAGCCAAAGGAAGATTCCCGCCAAGGTTGTCCGCAGCTACCGGAAGCAGGAACCAAGCTTAGGCTGCTCCATCCCAGCTATCCTGTTCTTGCCCCGCAAGCGCTCTCAGGCAGAGCTATGTGCAGACCCAAAGGAGCTCTGGGTGCAGCAGCTGATGCAGCATCTGGACAAGACACCATCCCCACAGAAACCAGCCCAGGGCTGCAGGAAGGACAGGGGGGCCTCCAAGACTGGCAAGAAAGGAAAGGGCTCCAAAGGCTGCAAGAGGACTGAGCGGTCACAGACCCCTAAAGGGCCATAG |
| ORF Protein Sequence | MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T93237-Ab | Anti-CCL21/ 6Ckine/ CKb9 functional antibody |
| Target Antigen | GM-Tg-g-T93237-Ag | CCL21 protein |
| Cytokine | cks-Tg-g-GM-T93237 | chemokine (C-C motif) ligand 21 (CCL21) protein & antibody |
| ORF Viral Vector | pGMLP002050 | Human CCL21 Lentivirus plasmid |
| ORF Viral Vector | vGMLP002050 | Human CCL21 Lentivirus particle |
Target information
| Target ID | GM-T93237 |
| Target Name | CCL21 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
6366 |
| Gene ID |
101087275 (Felis catus), 18829 (Mus musculus), 298006 (Rattus norvegicus), 448796 (Canis lupus familiaris) 511112 (Bos taurus), 574183 (Macaca mulatta), 6366 (Homo sapiens) |
| Gene Symbols & Synonyms | CCL21,Ccl21a,Ccl21,ALP,SLC,plt,CKb9,Tca4,6Ckine,Gm1987,Scya21,6CKBAC2,SCYA21a,Scya21b,Ccl21b,ECL,TCA4,SCYA21 |
| Target Alternative Names | 6CKBAC2,6Ckine,ALP,Beta-chemokine exodus-2,C-C motif chemokine 21,CCL21,CKb9,Ccl21,Ccl21a,Ccl21b,ECL,Gm1987,SCYA21,SCYA21a,SLC,Scya21,Scya21b,Secondary lymphoid-tissue chemokine (SLC),Small-inducible cytokine A21,TCA4,Tca4,plt |
| Uniprot Accession |
O00585,P84444,Q8HYP5
Additional SwissProt Accessions: P84444,Q8HYP5,O00585 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Cytokine Target |
| Disease | cancer, ovarian cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, NF-kappa B signaling pathway |
| Gene Ensembl | ENSMUSG00000094686, ENSCAFG00845005361, ENSBTAG00000010161, ENSMMUG00000063081, ENSG00000137077 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


