Human LEP/LEPD/OB ORF/cDNA clone-Lentivirus plasmid (NM_000230.2)

Cat. No.: pGMLP001963
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LEP/LEPD/OB Lentiviral expression plasmid for LEP lentivirus packaging, LEP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to LEP/Leptin/LEP/LEPD products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $426
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001963
Gene Name LEP
Accession Number NM_000230.2
Gene ID 3952
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 504 bp
Gene Alias LEPD,OB,OBS
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCATTGGGGAACCCTGTGCGGATTCTTGTGGCTTTGGCCCTATCTTTTCTATGTCCAAGCTGTGCCCATCCAAAAAGTCCAAGATGACACCAAAACCCTCATCAAGACAATTGTCACCAGGATCAATGACATTTCACACACGCAGTCAGTCTCCTCCAAACAGAAAGTCACCGGTTTGGACTTCATTCCTGGGCTCCACCCCATCCTGACCTTATCCAAGATGGACCAGACACTGGCAGTCTACCAACAGATCCTCACCAGTATGCCTTCCAGAAACGTGATCCAAATATCCAACGACCTGGAGAACCTCCGGGATCTTCTTCACGTGCTGGCCTTCTCTAAGAGCTGCCACTTGCCCTGGGCCAGTGGCCTGGAGACCTTGGACAGCCTGGGGGGTGTCCTGGAAGCTTCAGGCTACTCCACAGAGGTGGTGGCCCTGAGCAGGCTGCAGGGGTCTCTGCAGGACATGCTGTGGCAGCTGGACCTCAGCCCTGGGTGCTGA
ORF Protein Sequence MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T79485-Ab Anti-LEP/ LEPD/ OB functional antibody
    Target Antigen GM-Tg-g-T79485-Ag LEP protein
    Cytokine cks-Tg-g-GM-T79485 leptin (LEP) protein & antibody
    ORF Viral Vector pGMLP001963 Human LEP Lentivirus plasmid
    ORF Viral Vector pGMLV001867 Human LEP Lentivirus plasmid
    ORF Viral Vector vGMLP001963 Human LEP Lentivirus particle
    ORF Viral Vector vGMLV001867 Human LEP Lentivirus particle


    Target information

    Target ID GM-T79485
    Target Name LEP/Leptin
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3952
    Gene ID 100034042 (Equus caballus), 16846 (Mus musculus), 25608 (Rattus norvegicus), 280836 (Bos taurus)
    3952 (Homo sapiens), 403616 (Canis lupus familiaris), 493838 (Felis catus), 698728 (Macaca mulatta)
    Gene Symbols & Synonyms LEP,Lep,ob,obese,OB,OBS,LEPD
    Target Alternative Names LEP,LEPD,Lep,Leptin,OB,OBS,Obese protein,Obesity factor,ob,obese
    Uniprot Accession O02720,P41159,P41160,P50595,P50596,Q28504,Q9N2C1,Q9TU09
    Additional SwissProt Accessions: Q9TU09,P41160,P50596,P50595,P41159,O02720,Q9N2C1,Q28504
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, Neuroactive ligand-receptor interaction, JAK-STAT signaling pathway, Adipocytokine signaling pathway
    Gene Ensembl ENSMUSG00000059201, ENSG00000174697, ENSCAFG00845025165, ENSMMUG00000005322
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.