Human GZMB/C11/CCPI ORF/cDNA clone-Lentivirus plasmid (NM_004131.5)

Cat. No.: pGMLP001949
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GZMB/C11/CCPI Lentiviral expression plasmid for GZMB lentivirus packaging, GZMB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to Granzyme B/GZMB/GZMB/C11 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $486
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001949
Gene Name GZMB
Accession Number NM_004131.5
Gene ID 3002
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 744 bp
Gene Alias C11,CCPI,CGL-1,CGL1,CSP-B,CSPB,CTLA1,CTSGL1,HLP,SECT
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAACCAATCCTGCTTCTGCTGGCCTTCCTCCTGCTGCCCAGGGCAGATGCAGGGGAGATCATCGGGGGACATGAGGCCAAGCCCCACTCCCGCCCCTACATGGCTTATCTTATGATCTGGGATCAGAAGTCTCTGAAGAGGTGCGGTGGCTTCCTGATACGAGACGACTTCGTGCTGACAGCTGCTCACTGTTGGGGAAGCTCCATAAATGTCACCTTGGGGGCCCACAATATCAAAGAACAGGAGCCGACCCAGCAGTTTATCCCTGTGAAAAGACCCATCCCCCATCCAGCCTATAATCCTAAGAACTTCTCCAACGACATCATGCTACTGCAGCTGGAGAGAAAGGCCAAGCGGACCAGAGCTGTGCAGCCCCTCAGGCTACCTAGCAACAAGGCCCAGGTGAAGCCAGGGCAGACATGCAGTGTGGCCGGCTGGGGGCAGACGGCCCCCCTGGGAAAACACTCACACACACTACAAGAGGTGAAGATGACAGTGCAGGAAGATCGAAAGTGCGAATCTGACTTACGCCATTATTACGACAGTACCATTGAGTTGTGCGTGGGGGACCCAGAGATTAAAAAGACTTCCTTTAAGGGGGACTCTGGAGGCCCTCTTGTGTGTAACAAGGTGGCCCAGGGCATTGTCTCCTATGGACGAAACAATGGCATGCCTCCACGAGCCTGCACCAAAGTCTCAAGCTTTGTACACTGGATAAAGAAAACCATGAAACGCTACTAA
ORF Protein Sequence MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T08298-Ab Anti-GRAB/ GZMB/ C11 functional antibody
    Target Antigen GM-Tg-g-T08298-Ag GZMB protein
    ORF Viral Vector pGMLP001949 Human GZMB Lentivirus plasmid
    ORF Viral Vector vGMLP001949 Human GZMB Lentivirus particle


    Target information

    Target ID GM-T08298
    Target Name Granzyme B/GZMB
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3002
    Gene ID 14939 (Mus musculus), 3002 (Homo sapiens), 716518 (Macaca mulatta)
    Gene Symbols & Synonyms Gzmb,GZMB,GZB,CCP1,Ctla1,Ctla-1,CCP-1/C11,C11,HLP,CCPI,CGL1,CSPB,SECT,CGL-1,CSP-B,CTLA1,CTSGL1
    Target Alternative Names Granzyme B, GZMB,Granzyme B,C11, CTLA-1, Cathepsin G-like 1 (CTSGL1), Cytotoxic T-lymphocyte proteinase 2 (Lymphocyte protease), Fragmentin-2, Granzyme-2, Human lymphocyte protein (HLP), SECT, T-cell serine protease 1-3E,C11,HLP,CCPI,CGL1,CSPB,SECT,CGL-1,CSP-B,CTLA1,CTSGL1
    Uniprot Accession P04187,P10144
    Additional SwissProt Accessions: P04187,P10144
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Apoptosis, Natural killer cell mediated cytotoxicity, Type I diabetes mellitus, Autoimmune thyroid disease, Allograft rejection, Graft-versus-host disease
    Gene Ensembl ENSMUSG00000015437, ENSG00000100453
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.