Human ANG/ALS9/HEL168 ORF/cDNA clone-Lentivirus plasmid (NM_001145.4 )

Cat. No.: pGMLP001909
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ANG/ALS9/HEL168 Lentiviral expression plasmid for ANG lentivirus packaging, ANG lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to Angiogenin/ANG/ANG/ALS9 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001909
Gene Name ANG
Accession Number NM_001145.4
Gene ID 283
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 444 bp
Gene Alias ALS9,HEL168,RAA1,RNASE4,RNASE5
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGATGGGCCTGGGCGTTTTGTTGTTGGTCTTCGTGCTGGGTCTGGGTCTGACCCCACCGACCCTGGCTCAGGATAACTCCAGGTACACACACTTCCTGACCCAGCACTATGATGCCAAACCACAGGGCCGGGATGACAGATACTGTGAAAGCATCATGAGGAGACGGGGCCTGACCTCACCCTGCAAAGACATCAACACATTTATTCATGGCAACAAGCGCAGCATCAAGGCCATCTGTGAAAACAAGAATGGAAACCCTCACAGAGAAAACCTAAGAATAAGCAAGTCTTCTTTCCAGGTCACCACTTGCAAGCTACATGGAGGTTCCCCCTGGCCTCCATGCCAGTACCGAGCCACAGCGGGGTTCAGAAACGTTGTTGTTGCTTGTGAAAATGGCTTACCTGTCCACTTGGATCAGTCAATTTTCCGTCGTCCGTAA
ORF Protein Sequence MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T54229-Ab Anti-ANGI/ ANG/ ALS9 functional antibody
    Target Antigen GM-Tg-g-T54229-Ag ANG protein
    ORF Viral Vector pGMLP000061 Human ANG Lentivirus plasmid
    ORF Viral Vector pGMLP001909 Human ANG Lentivirus plasmid
    ORF Viral Vector vGMLP000061 Human ANG Lentivirus particle
    ORF Viral Vector vGMLP001909 Human ANG Lentivirus particle


    Target information

    Target ID GM-T54229
    Target Name Angiogenin/ANG
    Gene Group Identifier
    (Target Gene ID in Homo species)
    283
    Gene ID 100034041 (Equus caballus), 101082240 (Felis catus), 11727 (Mus musculus), 283 (Homo sapiens)
    305843 (Rattus norvegicus)
    Gene Symbols & Synonyms ANG,Ang,RAB1,Ang1,Rnase5,Rnase5a,ALS9,RAA1,HEL168,RNASE4,RNASE5
    Target Alternative Names Angiogenin, ANG,Angiogenin,Ribonuclease 5 (RNase 5),ALS9,RAA1,HEL168,RNASE4,RNASE5
    Uniprot Accession P03950,P21570,Q5VI84
    Additional SwissProt Accessions: Q5VI84,P21570,P03950
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Lung Cancer, Malignant neoplasm of bladder, Dent disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000050635, ENSMUSG00000072115, ENSG00000214274
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.