Human RBP4/MCOPCB10/RDCCAS ORF/cDNA clone-Lentivirus plasmid (NM_006744.3 )
Cat. No.: pGMLP001901
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human RBP4/MCOPCB10/RDCCAS Lentiviral expression plasmid for RBP4 lentivirus packaging, RBP4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
RBP4/MCOPCB10 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP001901 |
| Gene Name | RBP4 |
| Accession Number | NM_006744.3 |
| Gene ID | 5950 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 606 bp |
| Gene Alias | MCOPCB10,RDCCAS |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAAGTGGGTGTGGGCGCTCTTGCTGTTGGCGGCGCTGGGCAGCGGCCGCGCGGAGCGCGACTGCCGAGTGAGCAGCTTCCGAGTCAAGGAGAACTTCGACAAGGCTCGCTTCTCTGGGACCTGGTACGCCATGGCCAAGAAGGACCCCGAGGGCCTCTTTCTGCAGGACAACATCGTCGCGGAGTTCTCCGTGGACGAGACCGGCCAGATGAGCGCCACAGCCAAGGGCCGAGTCCGTCTTTTGAATAACTGGGACGTGTGCGCAGACATGGTGGGCACCTTCACAGACACCGAGGACCCTGCCAAGTTCAAGATGAAGTACTGGGGCGTAGCCTCCTTTCTCCAGAAAGGAAATGATGACCACTGGATCGTCGACACAGACTACGACACGTATGCCGTGCAGTACTCCTGCCGCCTCCTGAACCTCGATGGCACCTGTGCTGACAGCTACTCCTTCGTGTTTTCCCGGGACCCCAACGGCCTGCCCCCAGAAGCGCAGAAGATTGTAAGGCAGCGGCAGGAGGAGCTGTGCCTGGCCAGGCAGTACAGGCTGATCGTCCACAACGGTTACTGCGATGGCAGATCAGAAAGAAACCTTTTGTAG |
| ORF Protein Sequence | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T55703-Ab | Anti-RET4/ RBP4/ MCOPCB10 functional antibody |
| Target Antigen | GM-Tg-g-T55703-Ag | RBP4 protein |
| Cytokine | cks-Tg-g-GM-T55703 | retinol binding protein 4 (RBP4) protein & antibody |
| ORF Viral Vector | pGMLP001901 | Human RBP4 Lentivirus plasmid |
| ORF Viral Vector | vGMLP001901 | Human RBP4 Lentivirus particle |
Target information
| Target ID | GM-T55703 |
| Target Name | RBP4 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
5950 |
| Gene ID |
100049790 (Equus caballus), 101094377 (Felis catus), 19662 (Mus musculus), 25703 (Rattus norvegicus) 281444 (Bos taurus), 477775 (Canis lupus familiaris), 5950 (Homo sapiens), 701270 (Macaca mulatta) |
| Gene Symbols & Synonyms | RBP4,Rbp4,RBP,PRBP,fCP1,Rbp-4,RBPA,RDCCAS,MCOPCB10 |
| Target Alternative Names | MCOPCB10,PRBP,Plasma retinol-binding protein (PRBP,RBP,RBP),RBP4,RBPA,RDCCAS,Rbp-4,Rbp4,Retinol-binding protein 4,fCP1 |
| Uniprot Accession |
M5AXY1,P02753,P04916,P18902,Q00724,Q28369
Additional SwissProt Accessions: Q28369,M5AXY1,Q00724,P04916,P18902,P02753 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Diagnostics Biomarker, Cytokine Target |
| Disease | Lung Cancer, Complications of kidney transplant, Acute kidney failure, Chronic Kidney Disease, Dent disease, Diabetic Nephropathy, Nephrotic syndrome, Nephrotic syndrome with focal and segmental glomerular lesions, Perinatal necrotizing enterocolitis, Type 1 diabetes mellitus, Type 2 diabetes mellitus |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000034419, ENSMUSG00000024990, ENSBTAG00000000442, ENSG00000138207 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


