Human HMGB1/HMG-1/HMG1 ORF/cDNA clone-Lentivirus plasmid (NM_002128.5)

Cat. No.: pGMLP001892
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HMGB1/HMG-1/HMG1 Lentiviral expression plasmid for HMGB1 lentivirus packaging, HMGB1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to HMGB1/HMG-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $462
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001892
Gene Name HMGB1
Accession Number NM_002128.5
Gene ID 3146
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 648 bp
Gene Alias HMG-1,HMG1,HMG3,SBP-1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCAAAGGAGATCCTAAGAAGCCGAGAGGCAAAATGTCATCATATGCATTTTTTGTGCAAACTTGTCGGGAGGAGCATAAGAAGAAGCACCCAGATGCTTCAGTCAACTTCTCAGAGTTTTCTAAGAAGTGCTCAGAGAGGTGGAAGACCATGTCTGCTAAAGAGAAAGGAAAATTTGAAGATATGGCAAAAGCGGACAAGGCCCGTTATGAAAGAGAAATGAAAACCTATATCCCTCCCAAAGGGGAGACAAAAAAGAAGTTCAAGGATCCCAATGCACCCAAGAGGCCTCCTTCGGCCTTCTTCCTCTTCTGCTCTGAGTATCGCCCAAAAATCAAAGGAGAACATCCTGGCCTGTCCATTGGTGATGTTGCGAAGAAACTGGGAGAGATGTGGAATAACACTGCTGCAGATGACAAGCAGCCTTATGAAAAGAAGGCTGCGAAGCTGAAGGAAAAATACGAAAAGGATATTGCTGCATATCGAGCTAAAGGAAAGCCTGATGCAGCAAAAAAGGGAGTTGTCAAGGCTGAAAAAAGCAAGAAAAAGAAGGAAGAGGAGGAAGATGAGGAAGATGAAGAGGATGAGGAGGAGGAGGAAGATGAAGAAGATGAAGATGAAGAAGAAGATGATGATGATGAATAA
ORF Protein Sequence MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T63595-Ab Anti-HMGB1/ HMG-1/ HMG1 monoclonal antibody
    Target Antigen GM-Tg-g-T63595-Ag HMGB1 VLP (virus-like particle)
    ORF Viral Vector pGMLP001892 Human HMGB1 Lentivirus plasmid
    ORF Viral Vector pGMLV002391 Human HMGB1 Lentivirus plasmid
    ORF Viral Vector pGMAP000070 Human HMGB1 Adenovirus plasmid
    ORF Viral Vector pGMAP000231 Human HMGB1 Adenovirus plasmid
    ORF Viral Vector pGMPC000590 Human HMGB1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC004728 Human HMGB1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP001892 Human HMGB1 Lentivirus particle
    ORF Viral Vector vGMLV002391 Human HMGB1 Lentivirus particle
    ORF Viral Vector vGMAP000070 Human HMGB1 Adenovirus particle
    ORF Viral Vector vGMAP000231 Human HMGB1 Adenovirus particle


    Target information

    Target ID GM-T63595
    Target Name HMGB1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3146
    Gene ID 100033873 (Equus caballus), 101089823 (Felis catus), 15289 (Mus musculus), 25459 (Rattus norvegicus)
    282691 (Bos taurus), 3146 (Homo sapiens), 403170 (Canis lupus familiaris), 712849 (Macaca mulatta)
    Gene Symbols & Synonyms HMGB1,Hmgb1,HMG-1,p30,Hmg1,SBP-1,Ac2-008,HMG1,HMG3
    Target Alternative Names Ac2-008,HMG-1,HMG1,HMG3,HMGB1,High mobility group protein 1 (HMG-1),High mobility group protein B1,Hmg1,Hmgb1,SBP-1,p30
    Uniprot Accession P09429,P10103,P63158,P63159,Q08IE6,Q6YKA4
    Additional SwissProt Accessions: Q08IE6,P63158,P63159,P10103,P09429,Q6YKA4
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease cancer, Ovary Cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000008439, ENSMUSG00000066551, ENSBTAG00000018103, ENSG00000189403, ENSCAFG00845021967, ENSMMUG00000046615
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.