Human IFITM5/BRIL/DSPA1 ORF/cDNA clone-Lentivirus plasmid (NM_001025295)
Cat. No.: pGMLP001871
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IFITM5/BRIL/DSPA1 Lentiviral expression plasmid for IFITM5 lentivirus packaging, IFITM5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IFITM5/BRIL products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP001871 |
Gene Name | IFITM5 |
Accession Number | NM_001025295 |
Gene ID | 387733 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 399 bp |
Gene Alias | BRIL,DSPA1,fragilis4,Hrmp1,OI5 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGACACGGCGTATCCCCGCGAGGACACCCGGGCCCCCACGCCCAGCAAGGCCGGTGCCCACACAGCCCTCACACTGGGGGCCCCGCACCCCCCGCCTCGAGACCACTTGATCTGGTCGGTGTTCAGCACCCTCTACCTGAATCTGTGTTGCCTCGGCTTCCTGGCGCTGGCCTACTCCATCAAGGCCCGAGATCAGAAGGTGGTTGGTGACCTGGAAGCGGCCCGGCGTTTTGGCTCCAAAGCCAAGTGCTACAACATCCTGGCCGCGATGTGGACGCTGGTGCCGCCACTGCTGCTCCTGGGGCTGGTGGTGACTGGTGCCCTGCACCTGGCCCGGCTGGCCAAGGACTCTGCCGCCTTCTTCAGCACCAAGTTTGATGACGCGGACTATGACTGA |
ORF Protein Sequence | MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADYD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0606-Ab | Anti-IFM5/ IFITM5/ BRIL monoclonal antibody |
Target Antigen | GM-Tg-g-MP0606-Ag | IFITM5 VLP (virus-like particle) |
ORF Viral Vector | pGMLP000848 | Human IFITM5 Lentivirus plasmid |
ORF Viral Vector | pGMLP001871 | Human IFITM5 Lentivirus plasmid |
ORF Viral Vector | vGMLP000848 | Human IFITM5 Lentivirus particle |
ORF Viral Vector | vGMLP001871 | Human IFITM5 Lentivirus particle |
Target information
Target ID | GM-MP0606 |
Target Name | IFITM5 |
Gene Group Identifier (Target Gene ID in Homo species) |
387733 |
Gene ID |
100050873 (Equus caballus), 101101083 (Felis catus), 119864192 (Canis lupus familiaris), 293617 (Rattus norvegicus) 387733 (Homo sapiens), 526461 (Bos taurus), 697314 (Macaca mulatta), 73835 (Mus musculus) |
Gene Symbols & Synonyms | IFITM5,Ifitm5,OI5,BRIL,DSPA1,Hrmp1,fragilis4,Bril,Hrtm1,1110003J06Rik |
Target Alternative Names | IFITM5,Interferon-induced transmembrane protein 5,Bone-restricted interferon-induced transmembrane protein-like protein (BRIL), Dispanin subfamily A member 1 (DSPA1),OI5,BRIL,DSPA1,Hrmp1,fragilis4 |
Uniprot Accession |
A6NNB3,O88728
Additional SwissProt Accessions: A6NNB3,O88728 |
Uniprot Entry Name | |
Protein Sub-location | Transmembrane Protein |
Category | |
Disease | |
Disease from KEGG | |
Gene Ensembl | ENSECAG00000035238, ENSCAFG00845028633, ENSG00000206013, ENSMMUG00000004626, ENSMUSG00000025489 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.