Human IFITM5/BRIL/DSPA1 ORF/cDNA clone-Lentivirus plasmid (NM_001025295)

Cat. No.: pGMLP001871
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IFITM5/BRIL/DSPA1 Lentiviral expression plasmid for IFITM5 lentivirus packaging, IFITM5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IFITM5/BRIL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001871
Gene Name IFITM5
Accession Number NM_001025295
Gene ID 387733
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 399 bp
Gene Alias BRIL,DSPA1,fragilis4,Hrmp1,OI5
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACACGGCGTATCCCCGCGAGGACACCCGGGCCCCCACGCCCAGCAAGGCCGGTGCCCACACAGCCCTCACACTGGGGGCCCCGCACCCCCCGCCTCGAGACCACTTGATCTGGTCGGTGTTCAGCACCCTCTACCTGAATCTGTGTTGCCTCGGCTTCCTGGCGCTGGCCTACTCCATCAAGGCCCGAGATCAGAAGGTGGTTGGTGACCTGGAAGCGGCCCGGCGTTTTGGCTCCAAAGCCAAGTGCTACAACATCCTGGCCGCGATGTGGACGCTGGTGCCGCCACTGCTGCTCCTGGGGCTGGTGGTGACTGGTGCCCTGCACCTGGCCCGGCTGGCCAAGGACTCTGCCGCCTTCTTCAGCACCAAGTTTGATGACGCGGACTATGACTGA
ORF Protein Sequence MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADYD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0606-Ab Anti-IFM5/ IFITM5/ BRIL monoclonal antibody
    Target Antigen GM-Tg-g-MP0606-Ag IFITM5 VLP (virus-like particle)
    ORF Viral Vector pGMLP000848 Human IFITM5 Lentivirus plasmid
    ORF Viral Vector pGMLP001871 Human IFITM5 Lentivirus plasmid
    ORF Viral Vector vGMLP000848 Human IFITM5 Lentivirus particle
    ORF Viral Vector vGMLP001871 Human IFITM5 Lentivirus particle


    Target information

    Target ID GM-MP0606
    Target Name IFITM5
    Gene Group Identifier
    （Target Gene ID in Homo species)         		387733
    Gene ID 100050873 (Equus caballus), 101101083 (Felis catus), 119864192 (Canis lupus familiaris), 293617 (Rattus norvegicus)
    387733 (Homo sapiens), 526461 (Bos taurus), 697314 (Macaca mulatta), 73835 (Mus musculus)
    Gene Symbols & Synonyms IFITM5,Ifitm5,OI5,BRIL,DSPA1,Hrmp1,fragilis4,Bril,Hrtm1,1110003J06Rik
    Target Alternative Names IFITM5,Interferon-induced transmembrane protein 5,Bone-restricted interferon-induced transmembrane protein-like protein (BRIL), Dispanin subfamily A member 1 (DSPA1),OI5,BRIL,DSPA1,Hrmp1,fragilis4
    Uniprot Accession A6NNB3,O88728
    Additional SwissProt Accessions: A6NNB3,O88728
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000035238, ENSCAFG00845028633, ENSG00000206013, ENSMMUG00000004626, ENSMUSG00000025489
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.