Human FOLR2/BETA-HFR/FBP ORF/cDNA clone-Lentivirus plasmid (NM_000803)

Cat. No.: pGMLP001866
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FOLR2/BETA-HFR/FBP Lentiviral expression plasmid for FOLR2 lentivirus packaging, FOLR2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FOLR2/BETA-HFR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $492
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001866
Gene Name FOLR2
Accession Number NM_000803
Gene ID 2350
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 768 bp
Gene Alias BETA-HFR,FBP,FBP/PL-1,FR-BETA,FR-P3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTCTGGAAATGGATGCCACTTCTGCTGCTTCTGGTCTGTGTAGCCACCATGTGCAGTGCCCAGGACAGGACTGATCTCCTCAATGTCTGTATGGATGCCAAGCACCACAAGACAAAGCCAGGTCCTGAGGACAAGCTGCATGACCAATGCAGTCCCTGGAAGAAGAATGCCTGCTGCACAGCCAGCACCAGCCAGGAGCTGCACAAGGACACCTCCCGCCTGTACAACTTTAACTGGGACCACTGCGGCAAGATGGAGCCCGCCTGCAAGCGCCACTTCATCCAGGACACCTGTCTCTATGAGTGCTCACCCAACCTGGGGCCCTGGATCCAGCAGGTGAATCAGAGCTGGCGCAAAGAACGCTTCCTGGATGTGCCCTTATGCAAAGAGGACTGTCAGCGCTGGTGGGAGGATTGTCACACCTCCCACACGTGCAAGAGCAACTGGCACAGAGGATGGGACTGGACCTCAGGAGTTAACAAGTGCCCAGCTGGGGCTCTCTGCCGCACCTTTGAGTCCTACTTCCCCACTCCAGCTGCCCTTTGTGAAGGCCTCTGGAGTCACTCATACAAGGTCAGCAACTACAGCCGAGGGAGCGGCCGCTGCATCCAGATGTGGTTTGATTCAGCCCAGGGCAACCCCAACGAGGAAGTGGCGAGGTTCTATGCTGCAGCCATGCATGTGAATGCTGGTGAGATGCTTCATGGGACTGGGGGTCTCCTGCTCAGTCTGGCCCTGATGCTGCAACTCTGGCTCCTTGGCTGA
ORF Protein Sequence MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGGLLLSLALMLQLWLLG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T82297-Ab Anti-FOLR2/ BETA-HFR/ FBP monoclonal antibody
    Target Antigen GM-Tg-g-T82297-Ag FOLR2 VLP (virus-like particle)
    ORF Viral Vector pGMLP001866 Human FOLR2 Lentivirus plasmid
    ORF Viral Vector vGMLP001866 Human FOLR2 Lentivirus particle


    Target information

    Target ID GM-T82297
    Target Name FOLR2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		2350
    Gene ID 101095853 (Felis catus), 14276 (Mus musculus), 2350 (Homo sapiens), 293154 (Rattus norvegicus)
    507672 (Bos taurus), 718405 (Macaca mulatta)
    Gene Symbols & Synonyms FOLR2,Folr2,FBP2,FR-P3,Folbp2,FR-beta,Folbp-2,FBP,FOLR1,FRbeta,FR-BETA,BETA-HFR,FBP/PL-1
    Target Alternative Names BETA-HFR,FBP,FBP/PL-1,FBP2,FOLR1,FOLR2,FR-BETA,FR-P3,FR-beta,FRbeta,Folate receptor,Folate receptor 2,Folate receptor beta,Folbp-2,Folbp2,Folr2,Placental folate-binding protein (FBP),fetal/placental
    Uniprot Accession P14207,Q05685
    Additional SwissProt Accessions: Q05685,P14207
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease
    Disease from KEGG Antifolate resistance
    Gene Ensembl ENSMUSG00000032725, ENSG00000165457, ENSBTAG00000027684, ENSMMUG00000010453
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.