Human TNFSF4/CD134L/CD252 ORF/cDNA clone-Lentivirus plasmid (NM_003326)

Cat. No.: pGMLP001853
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TNFSF4/CD134L/CD252 Lentiviral expression plasmid for TNFSF4 lentivirus packaging, TNFSF4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to OX40L/TNFSF4/CD252/OX40/TNFSF4/CD134L products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $438
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001853
Gene Name TNFSF4
Accession Number NM_003326
Gene ID 7292
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 552 bp
Gene Alias CD134L,CD252,GP34,OX-40L,OX4OL,TNLG2B,TXGP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAAAGGGTCCAACCCCTGGAAGAGAATGTGGGAAATGCAGCCAGGCCAAGATTCGAGAGGAACAAGCTATTGCTGGTGGCCTCTGTAATTCAGGGACTGGGGCTGCTCCTGTGCTTCACCTACATCTGCCTGCACTTCTCTGCTCTTCAGGTATCACATCGGTATCCTCGAATTCAAAGTATCAAAGTACAATTTACCGAATATAAGAAGGAGAAAGGTTTCATCCTCACTTCCCAAAAGGAGGATGAAATCATGAAGGTGCAGAACAACTCAGTCATCATCAACTGTGATGGGTTTTATCTCATCTCCCTGAAGGGCTACTTCTCCCAGGAAGTCAACATTAGCCTTCATTACCAGAAGGATGAGGAGCCCCTCTTCCAACTGAAGAAGGTCAGGTCTGTCAACTCCTTGATGGTGGCCTCTCTGACTTACAAAGACAAAGTCTACTTGAATGTGACCACTGACAATACCTCCCTGGATGACTTCCATGTGAATGGCGGAGAACTGATTCTTATCCATCAAAATCCTGGTGAATTCTGTGTCCTTTGA
ORF Protein Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-553 Pre-Made Tavolimab biosimilar, Whole mAb, Anti-TNFSF4/OX40 Antibody: Anti-CD134L/CD252/GP34/OX-40L/OX4OL/TNLG2B/TXGP1 therapeutic antibody
    Biosimilar GMP-Bios-ab-417 Pre-Made Oxelumab biosimilar, Whole mAb, Anti-TNFSF4/OX40 Antibody: Anti-CD134L/CD252/GP34/OX-40L/OX4OL/TNLG2B/TXGP1 therapeutic antibody
    Biosimilar GMP-Bios-ab-554 Pre-Made Tavolixizumab biosimilar, Whole mAb, Anti-TNFSF4/OX40 Antibody: Anti-CD134L/CD252/GP34/OX-40L/OX4OL/TNLG2B/TXGP1 therapeutic antibody
    Biosimilar GMP-Bios-ab-022 Pre-Made Amlitelimab biosimilar, Whole mAb, Anti-TNFSF4/OX40 Antibody: Anti-CD134L/CD252/GP34/OX-40L/OX4OL/TNLG2B/TXGP1 therapeutic antibody
    Target Antibody GM-Tg-g-T55860-Ab Anti-TNFL4/ OX40/ TNFSF4 monoclonal antibody
    Target Antigen GM-Tg-g-T55860-Ag OX40/TNFSF4 VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T55860 tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4) protein & antibody
    ORF Viral Vector pGMLP001853 Human TNFSF4 Lentivirus plasmid
    ORF Viral Vector pGMLV001892 Human TNFSF4 Lentivirus plasmid
    ORF Viral Vector vGMLP001853 Human TNFSF4 Lentivirus particle
    ORF Viral Vector vGMLV001892 Human TNFSF4 Lentivirus particle


    Target information

    Target ID GM-T55860
    Target Name OX40L/TNFSF4/CD252/OX40
    Gene Group Identifier
    (Target Gene ID in Homo species)
    7292
    Gene ID 100060605 (Equus caballus), 100855878 (Canis lupus familiaris), 22164 (Mus musculus), 539800 (Bos taurus)
    706255 (Macaca mulatta), 7292 (Homo sapiens), 790947 (Felis catus), 89814 (Rattus norvegicus)
    Gene Symbols & Synonyms TNFSF4,Tnfsf4,TNLG2B,Ath1,gp34,Ath-1,Ox40l,TXGP1,CD134L,OX-40L,Tnlg2b,Txgp1l,GP34,CD252,OX4OL
    Target Alternative Names Ath-1,Ath1,CD134L,CD252,GP34,Glycoprotein Gp34,OX-40L,OX40,OX40 ligand (OX40L),OX40L,OX4OL,Ox40l,TAX transcriptionally-activated glycoprotein 1,TNFSF4,TNLG2B,TXGP1,Tnfsf4,Tnlg2b,Tumor necrosis factor ligand superfamily member 4,Txgp1l,gp34
    Uniprot Accession P23510,P43488,Q9Z2P3
    Additional SwissProt Accessions: P43488,P23510,Q9Z2P3
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction
    Gene Ensembl ENSECAG00000021182, ENSCAFG00845012176, ENSMUSG00000026700, ENSBTAG00000002894, ENSMMUG00000061368, ENSG00000117586
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.