Human TIMP1/CLGI/EPA ORF/cDNA clone-Lentivirus plasmid (NM_003254)
Cat. No.: pGMLP001347
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TIMP1/CLGI/EPA Lentiviral expression plasmid for TIMP1 lentivirus packaging, TIMP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
TIMP1/CLGI products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP001347 |
| Gene Name | TIMP1 |
| Accession Number | NM_003254 |
| Gene ID | 7076 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 624 bp |
| Gene Alias | CLGI,EPA,EPO,HCI,TIMP,TIMP-1 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCCCCTTTGAGCCCCTGGCTTCTGGCATCCTGTTGTTGCTGTGGCTGATAGCCCCCAGCAGGGCCTGCACCTGTGTCCCACCCCACCCACAGACGGCCTTCTGCAATTCCGACCTCGTCATCAGGGCCAAGTTCGTGGGGACACCAGAAGTCAACCAGACCACCTTATACCAGCGTTATGAGATCAAGATGACCAAGATGTATAAAGGGTTCCAAGCCTTAGGGGATGCCGCTGACATCCGGTTCGTCTACACCCCCGCCATGGAGAGTGTCTGCGGATACTTCCACAGGTCCCACAACCGCAGCGAGGAGTTTCTCATTGCTGGAAAACTGCAGGATGGACTCTTGCACATCACTACCTGCAGTTTTGTGGCTCCCTGGAACAGCCTGAGCTTAGCTCAGCGCCGGGGCTTCACCAAGACCTACACTGTTGGCTGTGAGGAATGCACAGTGTTTCCCTGTTTATCCATCCCCTGCAAACTGCAGAGTGGCACTCATTGCTTGTGGACGGACCAGCTCCTCCAAGGCTCTGAAAAGGGCTTCCAGTCCCGTCACCTTGCCTGCCTGCCTCGGGAGCCAGGGCTGTGCACCTGGCAGTCCCTGCGGTCCCAGATAGCCTGA |
| ORF Protein Sequence | MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0506-Ab | Anti-TIMP1/ CLGI/ EPA functional antibody |
| Target Antigen | GM-Tg-g-SE0506-Ag | TIMP1 protein |
| ORF Viral Vector | pGMLP001347 | Human TIMP1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000257 | Human TIMP1 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000455 | Human TIMP1 Adenovirus plasmid |
| ORF Viral Vector | pGMAP000469 | Human TIMP1 Adenovirus plasmid |
| ORF Viral Vector | pGMAP000553 | Human TIMP1 Adenovirus plasmid |
| ORF Viral Vector | pGMPC001587 | Human TIMP1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP001347 | Human TIMP1 Lentivirus particle |
| ORF Viral Vector | vGMLV000257 | Human TIMP1 Lentivirus particle |
| ORF Viral Vector | vGMAP000455 | Human TIMP1 Adenovirus particle |
| ORF Viral Vector | vGMAP000469 | Human TIMP1 Adenovirus particle |
| ORF Viral Vector | vGMAP000553 | Human TIMP1 Adenovirus particle |
Target information
| Target ID | GM-SE0506 |
| Target Name | TIMP1 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
7076 |
| Gene ID |
100034220 (Equus caballus), 101095886 (Felis catus), 116510 (Rattus norvegicus), 21857 (Mus musculus) 282092 (Bos taurus), 403816 (Canis lupus familiaris), 574348 (Macaca mulatta), 7076 (Homo sapiens) |
| Gene Symbols & Synonyms | TIMP1,Timp1,TIMP-1,Timp,EPA,Clgi,TPA-S1,EPO,HCI,CLGI,TIMP |
| Target Alternative Names | CLGI,Clgi,EPA,EPO,Erythroid-potentiating activity (EPA),Fibroblast collagenase inhibitor (Collagenase inhibitor),HCI,Metalloproteinase inhibitor 1,TIMP,TIMP-1,TIMP1,TPA-S1,Timp,Timp1,Tissue inhibitor of metalloproteinases 1 (TIMP-1) |
| Uniprot Accession |
O02722,P01033,P12032,P20414,P30120,P81546,Q95KL9
Additional SwissProt Accessions: O02722,P30120,P12032,P20414,P81546,Q95KL9,P01033 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Diagnostics Biomarker |
| Disease | cancer, Dent disease, Vesicoureteral reflux |
| Disease from KEGG | HIF-1 signaling pathway |
| Gene Ensembl | ENSECAG00000014259, ENSMUSG00000001131, ENSBTAG00000066152, ENSCAFG00845030572, ENSMMUG00000011426, ENSG00000102265 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


