Human PRSS2/TRY2/TRY8 ORF/cDNA clone-Lentivirus plasmid (NM_002770.3)

Cat. No.: pGMLP001201
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PRSS2/TRY2/TRY8 Lentiviral expression plasmid for PRSS2 lentivirus packaging, PRSS2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PRSS2/TRY2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $486
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001201
Gene Name PRSS2
Accession Number NM_002770.3
Gene ID 5645
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 744 bp
Gene Alias TRY2,TRY8,TRYP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAATCTACTTCTGATCCTTACCTTTGTTGCAGCTGCTGTTGCTGCCCCCTTTGATGATGATGACAAGATCGTTGGGGGCTACATCTGTGAGGAGAATTCTGTCCCCTACCAGGTGTCCTTGAATTCTGGCTACCACTTCTGCGGTGGCTCCCTCATCAGCGAACAGTGGGTGGTGTCAGCAGGTCACTGCTACAAGTCCCGCATCCAGGTGAGACTGGGAGAGCACAACATCGAAGTCCTGGAGGGGAATGAACAGTTCATCAATGCGGCCAAGATCATCCGCCACCCCAAATACAACAGCCGGACTCTGGACAATGACATCCTGCTGATCAAGCTCTCCTCACCTGCCGTCATCAATTCCCGCGTGTCCGCCATCTCTCTGCCCACTGCCCCTCCAGCTGCTGGCACCGAGTCCCTCATCTCCGGCTGGGGCAACACTCTGAGTTCTGGTGCCGACTACCCAGACGAGCTGCAGTGCCTGGATGCTCCTGTGCTGAGCCAGGCTGAGTGTGAAGCCTCCTACCCTGGAAAGATTACCAACAACATGTTCTGTGTGGGCTTCCTCGAGGGAGGCAAGGATTCCTGCCAGGGTGATTCTGGTGGCCCTGTGGTCTCCAATGGAGAGCTCCAAGGAATTGTCTCCTGGGGCTATGGCTGTGCCCAGAAGAACAGGCCTGGAGTCTACACCAAGGTCTACAACTATGTGGACTGGATTAAGGACACCATAGCTGCCAACAGCTAA
ORF Protein Sequence MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1211-Ab Anti-TRY2/ PRSS2/ TRY8 functional antibody
    Target Antigen GM-Tg-g-SE1211-Ag PRSS2 protein
    ORF Viral Vector pGMLP001201 Human PRSS2 Lentivirus plasmid
    ORF Viral Vector vGMLP001201 Human PRSS2 Lentivirus particle


    Target information

    Target ID GM-SE1211
    Target Name PRSS2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5645
    Gene ID 100686744 (Canis lupus familiaris), 101085707 (Felis catus), 111773305 (Equus caballus), 282603 (Bos taurus)
    5645 (Homo sapiens), 698352 (Macaca mulatta)
    Gene Symbols & Synonyms PRSS2,TRYP8,TRY2,TRY8,TRYP2,try10
    Target Alternative Names Anionic trypsinogen,PRSS2,Serine protease 2,TRY2,TRY8,TRYP2,TRYP8,Trypsin II,Trypsin-2,try10
    Uniprot Accession P06872,P07478,Q29463
    Additional SwissProt Accessions: P06872,Q29463,P07478
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease Pancreatitis, Acute pancreatitis
    Disease from KEGG Neuroactive ligand-receptor interaction, Pancreatic secretion, Protein digestion and absorption, Influenza A
    Gene Ensembl ENSCAFG00845018895, ENSECAG00000015872, ENSG00000275896, ENSMMUG00000051032
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.