Human SRSF3/SFRS3/SRp20 ORF/cDNA clone-Lentivirus plasmid (NM_003017)

Cat. No.: pGMLP000996
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SRSF3/SFRS3/SRp20 Lentiviral expression plasmid for SRSF3 lentivirus packaging, SRSF3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SRp20/SRSF3/SRSF3/SFRS3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000996
Gene Name SRSF3
Accession Number NM_003017
Gene ID 6428
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 495 bp
Gene Alias SFRS3,SRp20
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCATCGTGATTCCTGTCCATTGGACTGTAAGGTTTATGTAGGCAATCTTGGAAACAATGGCAACAAGACGGAATTGGAACGGGCTTTTGGCTACTATGGACCACTCCGAAGTGTGTGGGTTGCTAGAAACCCACCCGGCTTTGCTTTTGTTGAATTTGAAGATCCCCGAGATGCAGCTGATGCAGTCCGAGAGCTAGATGGAAGAACACTATGTGGCTGCCGTGTAAGAGTGGAACTGTCGAATGGTGAAAAAAGAAGTAGAAATCGTGGCCCACCTCCCTCTTGGGGTCGTCGCCCTCGAGATGATTATCGTAGGAGGAGTCCTCCACCTCGTCGCAGATCTCCAAGAAGGAGAAGCTTCTCTCGCAGCCGGAGCAGGTCCCTTTCTAGAGATAGGAGAAGAGAGAGATCGCTGTCTCGGGAGAGAAATCACAAGCCGTCCCGATCCTTCTCTAGGTCTCGTAGTCGATCTAGGTCAAATGAAAGGAAATAG
ORF Protein Sequence MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1820-Ab Anti-SRSF3 monoclonal antibody
    Target Antigen GM-Tg-g-IP1820-Ag SRSF3 protein
    ORF Viral Vector pGMLP000996 Human SRSF3 Lentivirus plasmid
    ORF Viral Vector pGMPC000966 Human SRSF3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000996 Human SRSF3 Lentivirus particle


    Target information

    Target ID GM-IP1820
    Target Name SRp20/SRSF3
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6428
    Gene ID 100053744 (Equus caballus), 101081223 (Felis catus), 20383 (Mus musculus), 361814 (Rattus norvegicus)
    403687 (Canis lupus familiaris), 540276 (Bos taurus), 6428 (Homo sapiens), 719123 (Macaca mulatta)
    Gene Symbols & Synonyms SRSF3,Srsf3,X16,Sfrs3,SFRS3,SRP20,SRp20
    Target Alternative Names Pre-mRNA-splicing factor SRP20,SFRS3,SRP20,SRSF3,SRp20,Serine/arginine-rich splicing factor 3,Sfrs3,Splicing factor,Srsf3,X16,arginine/serine-rich 3
    Uniprot Accession P84103,P84104,Q3SZR8
    Additional SwissProt Accessions: P84104,Q3SZR8,P84103
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000018741, ENSMUSG00000071172, ENSCAFG00845009568, ENSBTAG00000040006, ENSG00000112081
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.