Human NPPA/ANF/ANP ORF/cDNA clone-Lentivirus plasmid (NM_006172.3)

Cat. No.: pGMLP000970
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NPPA/ANF/ANP Lentiviral expression plasmid for NPPA lentivirus packaging, NPPA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to NPPA/ANF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000970
Gene Name NPPA
Accession Number NM_006172.3
Gene ID 4878
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 456 bp
Gene Alias ANF,ANP,ATFB6,ATRST2,CDD,CDD-ANF,CDP,PND
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCTCCTTCTCCACCACCACCGTGAGCTTCCTCCTTTTACTGGCATTCCAGCTCCTAGGTCAGACCAGAGCTAATCCCATGTACAATGCCGTGTCCAACGCAGACCTGATGGATTTCAAGAATTTGCTGGACCATTTGGAAGAAAAGATGCCTTTAGAAGATGAGGTCGTGCCCCCACAAGTGCTCAGTGAGCCGAATGAAGAAGCGGGGGCTGCTCTCAGCCCCCTCCCTGAGGTGCCTCCCTGGACCGGGGAAGTCAGCCCAGCCCAGAGAGATGGAGGTGCCCTCGGGCGGGGCCCCTGGGACTCCTCTGATCGATCTGCCCTCCTAAAAAGCAAGCTGAGGGCGCTGCTCACTGCCCCTCGGAGCCTGCGGAGATCCAGCTGCTTCGGGGGCAGGATGGACAGGATTGGAGCCCAGAGCGGACTGGGCTGTAACAGCTTCCGGTACTGA
ORF Protein Sequence MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0373-Ab Anti-ANF/ NPPA/ ANP functional antibody
    Target Antigen GM-Tg-g-SE0373-Ag NPPA protein
    ORF Viral Vector pGMLP000970 Human NPPA Lentivirus plasmid
    ORF Viral Vector pGMLV002264 Human NPPA Lentivirus plasmid
    ORF Viral Vector vGMLP000970 Human NPPA Lentivirus particle
    ORF Viral Vector vGMLV002264 Human NPPA Lentivirus particle


    Target information

    Target ID GM-SE0373
    Target Name NPPA
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4878
    Gene ID 100034201 (Equus caballus), 101100575 (Felis catus), 230899 (Mus musculus), 24602 (Rattus norvegicus)
    281355 (Bos taurus), 4878 (Homo sapiens), 608289 (Canis lupus familiaris), 714994 (Macaca mulatta)
    Gene Symbols & Synonyms NPPA,Nppa,CDD,proANF,proANP,preproANF,preproANP,ANP,Anf,Pnd,ANF,RATANF,CDP,PND,ATFB6,ATRST2,CDD-ANF
    Target Alternative Names NPPA,Natriuretic peptides A,Atrial natriuretic factor prohormone (proANF), Atrial natriuretic peptide prohormone (preproANP, proANP), Atriopeptigen, Cardiodilatin (CDD), preproCDD-ANF,ANF,ANP,CDD,CDP,PND,ATFB6,ATRST2,CDD-ANF
    Uniprot Accession P01160,P01161,P05125,P07499,P07501,P27104,Q9GLD0
    Additional SwissProt Accessions: P27104,Q9GLD0,P05125,P01161,P07501,P01160,P07499
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Diagnostics Biomarker
    Disease
    Disease from KEGG cGMP-PKG signaling pathway, cAMP signaling pathway, HIF-1 signaling pathway, Vascular smooth muscle contraction, Oxytocin signaling pathway, Regulation of lipolysis in adipocytes, Renin secretion, Aldosterone synthesis and secretion, African trypanosomiasis
    Gene Ensembl ENSECAG00000014892, ENSMUSG00000041616, ENSBTAG00000006709, ENSG00000175206, ENSCAFG00845001994, ENSMMUG00000007834
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.