Human DIO3/5DIII/D3 ORF/cDNA clone-Lentivirus plasmid (NM_001362)

Cat. No.: pGMLP000964
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human DIO3/5DIII/D3 Lentiviral expression plasmid for DIO3 lentivirus packaging, DIO3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to DIO3/5DIII products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $528.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000964
Gene Name DIO3
Accession Number NM_001362
Gene ID 1735
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 915 bp
Gene Alias 5DIII,D3,DIOIII,TXDI3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCTCGCCAGGCCACGTCGCGGTTGGTGGTCGGAGAGGGCGAGGGGTCCCAGGGGGCTTCGGGGCCTGCAGCCACCATGCTCCGCTCCCTGCTGCTTCACTCCTTGAGGCTCTGCGCCCAGACCGCCTCGTGCCTCGTGCTCTTCCCGCGCTTCCTCGGCACGGCCTTCATGCTCTGGCTTCTCGATTTCTTGTGTATCCGCAAGCATTTCCTGGGCCGCCGCCGCCGGGGGCAGCCCGAGCCCGAAGTGGAGCTCAACAGTGAAGGCGAGGAGGTGCCTCCCGATGACCCGCCCATCTGCGTGTCCGACGACAACCGCCTGTGCACCCTGGCGTCGCTCAAGGCGGTGTGGCATGGCCAGAAGTTGGATTTCTTCAAGCAGGCGCACGAGGGCGGTCCGGCGCCCAACTCCGAGGTGGTTCTGCCCGACGGCTTCCAGAGCCAGCACATCCTCGACTACGCGCAAGGGAACCGCCCGCTGGTTCTCAATTTCGGCAGCTGCACCTGACCACCGTTCATGGCGCGCATGAGCGCCTTCCAGCGCCTGGTCACTAAGTACCAGCGCGACGTCGACTTCCTCATCATCTACATCGAGGAAGCGCACCCCTCCGACGGCTGGGTCACCACGGACTCTCCCTACATCATCCCACAGCACCGGAGCCTGGAGGACCGGGTCAGCGCAGCGAGGGTACTGCAGCAAGGTGCACCCGGCTGCGCTCTGGTCCTCGACACCATGGCCAACTCCAGCAGCTCGGCCTATGGCGCCTACTTCGAGCGTCTCTATGTCATCCAGAGTGGCACTATTATGTACCAGGGCGGCCGTGGCCCCGACGGCTACCAGGTCTCTGAGCTGCGCACTTGGTTGGAACGCTATGATGAGCAACTGCACGGCGCTCGGCCCCGGAGGGTGTAA
ORF Protein Sequence MPRQATSRLVVGEGEGSQGASGPAATMLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLWLLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYIIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGARPRRV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0360-Ab Anti-IOD3/ DIO3/ 5DIII monoclonal antibody
    Target Antigen GM-Tg-g-MP0360-Ag DIO3 VLP (virus-like particle)
    ORF Viral Vector pGMLP000964 Human DIO3 Lentivirus plasmid
    ORF Viral Vector vGMLP000964 Human DIO3 Lentivirus particle


    Target information

    Target ID GM-MP0360
    Target Name DIO3
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1735
    Gene ID 100146344 (Equus caballus), 101094186 (Felis catus), 107585 (Mus musculus), 1735 (Homo sapiens)
    29475 (Rattus norvegicus), 494549 (Bos taurus), 612596 (Canis lupus familiaris), 708027 (Macaca mulatta)
    Gene Symbols & Synonyms DIO3,Dio3,D3,5DIII,TXDI3,DIOIII
    Target Alternative Names 5DIII,D3,DIO3,DIOIII,Dio3,TXDI3,Thyroxine 5-deiodinase,Type 3 DI,Type III iodothyronine deiodinase
    Uniprot Accession P49897,P55073,Q5I3B1,Q91ZI8
    Additional SwissProt Accessions: Q91ZI8,P55073,P49897,Q5I3B1
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Thyroid hormone signaling pathway
    Gene Ensembl ENSECAG00000005966, ENSMUSG00000075707, ENSG00000197406, ENSBTAG00000043578
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.