Human MESD/BOCA/MESDC2 ORF/cDNA clone-Lentivirus plasmid (NM_015154)

Cat. No.: pGMLP000952
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MESD/BOCA/MESDC2 Lentiviral expression plasmid for MESD lentivirus packaging, MESD lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MESDC2/MESD/MESD/BOCA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $476.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000952
Gene Name MESD
Accession Number NM_015154
Gene ID 23184
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 705 bp
Gene Alias BOCA,MESDC2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCTTCCAGGTGGGCGCGCAAGGCCGTGGTCCTGCTTTGTGCCTCTGACCTGCTGCTGCTGCTGCTACTGCTACCACCGCCTGGGTCCTGCGCGGCCGAAGGCTCGCCCGGGACGCCCGACGAGTCTACCCCACCTCCCCGGAAGAAGAAGAAGGATATTCGCGATTACAATGATGCAGACATGGCGCGTCTTCTGGAGCAATGGGAGAAAGATGATGACATTGAAGAAGGAGATCTTCCAGAGCACAAGAGACCTTCAGCACCTGTCGACTTCTCAAAGATAGACCCAAGCAAGCCTGAAAGCATATTGAAAATGACGAAAAAAGGGAAGACTCTCATGATGTTTGTCACTGTATCAGGAAGCCCTACTGAGAAGGAGACAGAGGAAATTACGAGCCTCTGGCAGGGCAGCCTTTTCAATGCCAACTATGACGTCCAGAGGTTCATTGTGGGATCAGACCGTGCTATCTTCATGCTTCGCGATGGGAGCTACGCCTGGGAGATCAAGGACTTTTTGGTCGGTCAAGACAGGTGTGCTGATGTAACTCTGGAGGGCCAGGTGTACCCCGGCAAAGGAGGAGGAAGCAAAGAGAAAAATAAAACAAAGCAAGACAAGGGCAAAAAAAAGAAGGAAGGAGATCTGAAATCTCGGTCTTCCAAGGAAGAAAATCGAGCTGGGAATAAAAGAGAAGACCTGTGA
ORF Protein Sequence MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2585-Ab Anti-MESD/ BOCAC2 monoclonal antibody
    Target Antigen GM-Tg-g-MP2585-Ag MESD VLP (virus-like particle)
    ORF Viral Vector pGMLP000952 Human MESD Lentivirus plasmid
    ORF Viral Vector pGMLP003470 Human MESD Lentivirus plasmid
    ORF Viral Vector vGMLP000952 Human MESD Lentivirus particle
    ORF Viral Vector vGMLP003470 Human MESD Lentivirus particle


    Target information

    Target ID GM-MP2585
    Target Name MESDC2/MESD
    Gene Group Identifier
    (Target Gene ID in Homo species)
    23184
    Gene ID 100067329 (Equus caballus), 101094422 (Felis catus), 23184 (Homo sapiens), 308796 (Rattus norvegicus)
    488765 (Canis lupus familiaris), 514610 (Bos taurus), 67943 (Mus musculus), 712993 (Macaca mulatta)
    Gene Symbols & Synonyms MESD,Mesd,MESDC2,BOCA,OI20,Mesdc2,msd,mesd,mKIAA0081,2210015O11Rik
    Target Alternative Names 2210015O11Rik,BOCA,LDLR chaperone MESD,LRP chaperone MESD,MESD,MESDC2,Mesd,Mesdc2,Mesoderm development LRP chaperone MESD,Mesoderm development candidate 2,Mesoderm development protein,OI20,Renal carcinoma antigen NY-REN-61,mKIAA0081,mesd,msd
    Uniprot Accession Q14696,Q3T0U1,Q5U2R7,Q9ERE7
    Additional SwissProt Accessions: Q14696,Q5U2R7,Q3T0U1,Q9ERE7
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000018394, ENSG00000117899, ENSMUSG00000038503, ENSMMUG00000009409
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.