Human CCL27/ALP/CTACK ORF/cDNA clone-Lentivirus plasmid (NM_006664)

Cat. No.: pGMLP000932
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCL27/ALP/CTACK Lentiviral expression plasmid for CCL27 lentivirus packaging, CCL27 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CCL27/ALP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000932
Gene Name CCL27
Accession Number NM_006664
Gene ID 10850
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 339 bp
Gene Alias ALP,CTACK,CTAK,ESKINE,ILC,PESKY,SCYA27
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGGGGCCCCCAACCTTCTGCAGCCTCCTGCTGCTGTCATTGCTCCTGAGCCCAGACCCTACAGCAGCATTCCTACTGCCACCCAGCACTGCCTGCTGTACTCAGCTCTACCGAAAGCCACTCTCAGACAAGCTACTGAGGAAGGTCATCCAGGTGGAACTGCAGGAGGCTGACGGGGACTGTCACCTCCAGGCTTTCGTGCTTCACCTGGCTCAACGCAGCATCTGCATCCACCCCCAGAACCCCAGCCTGTCACAGTGGTTTGAGCACCAAGAGAGAAAGCTCCATGGGACTCTGCCCAAGCTGAATTTTGGGATGCTAAGGAAAATGGGCTGA
ORF Protein Sequence MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0747-Ab Anti-CCL27/ ALP/ CTACK functional antibody
    Target Antigen GM-Tg-g-SE0747-Ag CCL27 protein
    Cytokine cks-Tg-g-GM-SE0747 chemokine (C-C motif) ligand 27 (CCL27) protein & antibody
    ORF Viral Vector pGMLP000932 Human CCL27 Lentivirus plasmid
    ORF Viral Vector vGMLP000932 Human CCL27 Lentivirus particle


    Target information

    Target ID GM-SE0747
    Target Name CCL27
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10850
    Gene ID 101086511 (Felis catus), 101902682 (Bos taurus), 102147669 (Equus caballus), 10850 (Homo sapiens)
    20301 (Mus musculus), 362505 (Rattus norvegicus), 445454 (Canis lupus familiaris), 574220 (Macaca mulatta)
    Gene Symbols & Synonyms CCL27,Ccl27a,Ccl27,ALP,ILC,CTAK,CTACK,PESKY,ESKINE,SCYA27,ESkine,Scya27,Scya27a
    Target Alternative Names ALP,C-C motif chemokine 27,CC chemokine ILC,CCL27,CTACK,CTAK,Ccl27,Ccl27a,Cutaneous T-cell-attracting chemokine (CTACK),ESKINE,ESkine,IL-11 R-alpha-locus chemokine,ILC,PESKY,SCYA27,Scya27,Scya27a,Skinkine,Small-inducible cytokine A27
    Uniprot Accession Q9Y4X3,Q9Z1X0
    Additional SwissProt Accessions: Q9Y4X3,Q9Z1X0
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway
    Gene Ensembl ENSBTAG00000014908, ENSG00000213927, ENSMUSG00000073888, ENSMMUG00000040429
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.