Human KCNE2/ATFB4/LQT5 ORF/cDNA clone-Lentivirus plasmid (NM_172201)
Cat. No.: pGMLP000905
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human KCNE2/ATFB4/LQT5 Lentiviral expression plasmid for KCNE2 lentivirus packaging, KCNE2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
KCNE2/ATFB4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000905 |
| Gene Name | KCNE2 |
| Accession Number | NM_172201 |
| Gene ID | 9992 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 372 bp |
| Gene Alias | ATFB4,LQT5,LQT6,MIRP1 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCTACTTTATCCAATTTCACACAGACGCTGGAAGACGTCTTCCGAAGGATTTTTATTACTTATATGGACAATTGGCGCCAGAACACAACAGCTGAGCAAGAGGCCCTCCAAGCCAAAGTTGATGCTGAGAACTTCTACTATGTCATCCTGTACCTCATGGTGATGATTGGAATGTTCTCTTTCATCATCGTGGCCATCCTGGTGAGCACTGTGAAATCCAAGAGACGGGAACACTCCAATGACCCCTACCACCAGTACATTGTAGAGGACTGGCAGGAAAAGTACAAGAGCCAAATCTTGAATCTAGAAGAATCGAAGGCCACCATCCATGAGAACATTGGTGCGGCTGGGTTCAAAATGTCCCCCTGA |
| ORF Protein Sequence | MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP0656-Ab | Anti-KCNE2/ ATFB4/ LQT5 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP0656-Ag | KCNE2 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000905 | Human KCNE2 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000905 | Human KCNE2 Lentivirus particle |
Target information
| Target ID | GM-MP0656 |
| Target Name | KCNE2 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
9992 |
| Gene ID |
100062720 (Equus caballus), 101086335 (Felis catus), 171138 (Rattus norvegicus), 246133 (Mus musculus) 403471 (Canis lupus familiaris), 768025 (Bos taurus), 9992 (Homo sapiens) |
| Gene Symbols & Synonyms | KCNE2,Kcne2,Mirp1,MiRP1,2200002I16Rik,LQT5,LQT6,ATFB4,MIRP1 |
| Target Alternative Names | 2200002I16Rik,ATFB4,KCNE2,Kcne2,LQT5,LQT6,MIRP1,MiRP1,MinK-related peptide 1 (MiRP1),Minimum potassium ion channel-related peptide 1,Mirp1,Potassium channel subunit beta MiRP1,Potassium voltage-gated channel subfamily E member 2 |
| Uniprot Accession |
P63161,Q9D808,Q9Y6J6
Additional SwissProt Accessions: P63161,Q9D808,Q9Y6J6 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | |
| Disease | |
| Disease from KEGG | Gastric acid secretion |
| Gene Ensembl | ENSECAG00000042684, ENSMUSG00000039672, ENSBTAG00000026260, ENSG00000159197 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


